KEGG   Pan paniscus (bonobo): 100974554
Entry
100974554         CDS       T02283                                 

Gene name
IL17D
Definition
(RefSeq) interleukin 17D
  KO
K05492  interleukin 17D
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04625  C-type lectin receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps04657  IL-17 signaling pathway
pps04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100974554 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100974554 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100974554 (IL17D)
   04659 Th17 cell differentiation
    100974554 (IL17D)
   04657 IL-17 signaling pathway
    100974554 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100974554 (IL17D)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100974554 (IL17D)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 100974554
NCBI-ProteinID: XP_008956755
Position
13
AA seq 202 aa
MLVAGFLLALPPSWAAGXPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQL
GPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCL
TGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSI
NSSIDKQGAKLLLGPNDAPAGP
NT seq 609 nt   +upstreamnt  +downstreamnt
atgctggtagccggcttcctgctggcgctgccgccgagctgggccgcgggcngcccgagg
gcgggcaggcgcccggcgcggccgcggggctgcgcggaccggccagaggagctactggag
cagctgtacgggcgcctggcggccggcgtgctcagcgccttccaccacacgctgcagctg
gggccgcgtgagcaggcgcgcaacgcgagctgcccggcagggggcaggcccgccgaccgc
cgcttccggccgcccaccaacctgcgcagcgtgtcgccctgggcctacagaatctcctac
gacccggcgaggtaccccaggtacctgcctgaagcctactgcctgtgccggggctgcctg
accgggctgttcggcgaggaggacgtgcgcttccgcagcgcccctgtctacatgcccacc
gtcgtcctgcgccgcacccccgcctgcgccggcggccgttccgtctacaccgaggcctac
gtcaccatccccgtgggctgcacctgcgtccccgagccggagaaggacgcagacagcatc
aactccagcatcgacaaacagggcgccaagctcctgctgggccccaacgacgcgcccgct
ggcccctga

DBGET integrated database retrieval system