KEGG   Pan paniscus (bonobo): 100974781
Entry
100974781         CDS       T02283                                 

Gene name
SRSF7
Definition
(RefSeq) serine and arginine rich splicing factor 7
  KO
K12896  splicing factor, arginine/serine-rich 7
Organism
pps  Pan paniscus (bonobo)
Pathway
pps03040  Spliceosome
pps05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100974781 (SRSF7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100974781 (SRSF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pps03041]
    100974781 (SRSF7)
Spliceosome [BR:pps03041]
 Common components
  Common spliceosomal components
   SR proteins
    100974781 (SRSF7)
SSDB
Motif
Pfam: RRM_1 zf-CCHC RRM_5 zf-CCHC_3
Other DBs
NCBI-GeneID: 100974781
NCBI-ProteinID: XP_008969134
UniProt: A0A2R8ZN62
Position
2A
AA seq 238 aa
MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDA
EDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH
RYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSR
SGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD
NT seq 717 nt   +upstreamnt  +downstreamnt
atgtcgcgttacgggcggtacggaggagaaaccaaggtgtatgttggtaacctgggaact
ggcgctggcaaaggagagttagaaagggctttcagttattatggtcctttaagaactgta
tggattgcgagaaatcctccaggatttgcctttgtggaattcgaagatcctagagatgca
gaagatgcagtacgaggactggatggaaaggtgatttgtggctcccgagtgagggttgaa
ctatcgacaggcatgcctcggagatcacgttttgatagaccacctgcccgacgtcccttt
gatccaaatgatagatgctatgagtgtggcgaaaagggacattatgcttatgattgtcat
cgttacagccggcgaagaagaagcaggtcacggtctagatcacattctcgatccagagga
aggcgatactctcgctcacgcagcaggagcaggggccgaaggtcaaggtcagcatctcct
cgacgatcaagatctatctctcttcgtagatcaagatcagcttcactcagaagatctagg
tctggttctattaaaggatcgaggtatttccaatccccgtcgaggtcaagatcaagatcc
aggtctatttcacgaccaagaagcagccgatcaaagtccagatctccatctccaaaaaga
agtcgttccccatcaggaagtcctcgcagaagtgcaagtcctgaaagaatggactga

DBGET integrated database retrieval system