KEGG   Pan paniscus (bonobo): 100974888Help
Entry
100974888         CDS       T02283                                 

Gene name
CCDC60
Definition
(RefSeq) coiled-coil domain containing 60
Organism
pps  Pan paniscus (bonobo)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4698
Motif
Other DBs
NCBI-GeneID: 100974888
NCBI-ProteinID: XP_003832450
UniProt: A0A2R9B6F0
Position
12
AA seq 550 aa AA seqDB search
MTKVPATKKLQSSPNAGAVRPFYASENLRQVPDKPMKSIKYMDKEIINLKKDLIRSRFLI
QSVKIGRGYFAILREETAKKKKQQQLQKLKEEERNKFQPAEKISEIHYGDTLLSTYDDEK
LKTLGARVTHRPFTPIHSCIISPSLPEAHVEPLFRQLCALHWLLEALTIDHTHHTMKPVI
TCWNPKDPGGSKSTIKKINKDKSMGQKWEHFVTAPKTKKFKIPTMRVTNRKPSRRGSTLS
LSRASGGSSPQSSMISVNPGSDEPPSVNTQVTSSKDIEDNESSSTKPDEEPLYMNLQKLL
EMVREDARRTVTIENGMQRKAPSILSVLKQNKSNSAYKEMQTTLKSSERSSSTSAESHIQ
PVQKKSKNRTNCDINIDYKSGVCNTMRAKFYSVAQEAGFCLQDKMEILMKRQEERGIQKF
RAFVLVSNFQKDIAKMRHHISVVKGDAEEIADHWYFDLLSKLPEDLKNFRPAKKILVKLQ
KFGENLDLRIRPHVLLKVLQDLRIWELCSPDIAVAIEFVREHIIHMPQEDYISWLQSRIN
IPIGPYSALR
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggttccagccaccaagaagcttcagagttcccccaacgcgggggctgtccgg
cccttttatgcctcggagaacctaaggcaggtcccagacaagccaatgaagagcatcaag
tatatggacaaggaaataataaacctcaaaaaggatcttatacgaagccgctttttgatc
cagtctgtgaagataggccgtggatattttgctattctgagggaagagactgcaaagaaa
aagaagcaacaacaacttcagaaactgaaagaggaggaaagaaataaattccagccagcc
gaaaagatctcagaaatccactatggggacaccttattgagcacatatgatgatgagaag
ttgaagacactgggagctagagtcacacatcgcccattcactcccatccacagctgcatc
atttctccctcgctacccgaggctcacgttgagcccctcttccgccagctctgtgctctc
cactggcttctggaggccctgactattgaccacacccaccacaccatgaagcctgtgatc
acctgctggaacccaaaggacccgggtggaagcaagagcaccattaaaaaaatcaataag
gacaagtccatgggacagaaatgggagcatttcgtcacagcgccaaagaccaagaaattc
aaaattcccacaatgcgagtcaccaaccgcaaaccaagccggcgaggctccacactcagt
ctgagtcgggccagtggggggtcctctccccagagcagcatgatctctgtgaaccctggc
tcggatgagcccccaagtgtgaacacccaggtgaccagcagcaaggacattgaggacaat
gagtcatcttcaaccaagccagatgaagaacctctgtatatgaatctgcagaagctcctg
gagatggttcgggaagatgcccggaggacagtcacaatagaaaatgggatgcaaagaaaa
gcacccagcatcttgtcagtgctgaaacaaaacaagagtaattctgcttataaggaaatg
cagaccactctcaaatcaagtgagagatccagcagtacaagtgcagaaagccacatccaa
ccagtccagaagaagtctaaaaaccgcactaattgtgacatcaacatcgactacaagagt
ggggtgtgtaacaccatgagggccaagttttacagcgtagcccaggaggctggcttctgc
ctgcaggacaagatggaaatcctcatgaagcgccaagaagagagaggtatccagaagttc
cgtgcttttgtccttgtctcaaattttcaaaaggacatagcaaaaatgagacatcacata
tctgtagtaaaaggagatgcagaagaaattgcagaccactggtactttgatctgttgtcc
aaactgccagaggatctaaagaacttccgccccgccaaaaagatcctggtgaaactgcag
aagtttggagaaaacctggacttgcggattcgaccccatgtcctcctgaaggtgctgcag
gatctgaggatttgggaactgtgctcccctgacatcgctgtggctattgagtttgtgcga
gaacacatcatccatatgcctcaagaggattacatcagctggctgcagagccggatcaac
atacccattgggccctacagcgccctgaggtag

DBGET integrated database retrieval system