KEGG   Pan paniscus (bonobo): 100975251
Entry
100975251         CDS       T02283                                 

Gene name
MEF2C
Definition
(RefSeq) myocyte enhancer factor 2C
  KO
K04454  MADS-box transcription enhancer factor 2C
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04371  Apelin signaling pathway
pps04921  Oxytocin signaling pathway
pps04928  Parathyroid hormone synthesis, secretion and action
pps05202  Transcriptional misregulation in cancer
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100975251 (MEF2C)
   04371 Apelin signaling pathway
    100975251 (MEF2C)
   04022 cGMP-PKG signaling pathway
    100975251 (MEF2C)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100975251 (MEF2C)
   04928 Parathyroid hormone synthesis, secretion and action
    100975251 (MEF2C)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100975251 (MEF2C)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100975251 (MEF2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100975251 (MEF2C)
Transcription factors [BR:pps03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    100975251 (MEF2C)
SSDB
Motif
Pfam: SRF-TF HJURP_C
Other DBs
NCBI-GeneID: 100975251
NCBI-ProteinID: XP_003822828
UniProt: A0A2R9BUT3
Position
5
AA seq 473 aa
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKI
NEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRN
SMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKS
PPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVAT
PTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPP
SALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSP
VDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggggagaaaaaagattcagattacgaggattatggatgaacgtaacagacaggtgaca
tttacaaagaggaaatttgggttgatgaagaaggcttatgagctgagcgtgctgtgtgac
tgtgagattgcactgatcatcttcaacagcaccaacaagctgttccagtatgccagcacc
gacatggacaaagtgcttctcaagtacacggagtacaacgagccgcatgagagccggaca
aactcagacatcgtggagacgttgagaaagaagggccttaatggctgtgacagcccagac
cccgatgcggacgattccgtaggtcacagccctgagtctgaggacaagtacaggaaaatt
aacgaagatattgatctaatgatcagcaggcaaagattgtgtgctgttccacctcccaac
ttcgagatgccagtctccatcccagtgtccagccacaacagtttggtgtacagcaaccct
gtcagctcactgggaaaccccaacctattgccactggctcatccttctctgcagaggaat
agtatgtctcctggtgtaacacatcgacctccaagtgcaggtaacacaggtggtctgatg
ggtggagacctcacatctggtgcaggcaccagtgcagggaacgggtatggcaatccccga
aactcaccaggtctgctggtctcacctggtaacttgaacaagaatatgcaagcaaaatct
cctcccccaatgaatttaggaatgaataaccgtaaaccagatctccgagttcttattcca
ccaggcagcaagaatacgatgccatcagtgtctgaggatgtcgacctgcttttgaatcaa
aggataaataactcccagtcggctcagtcattggctaccccagtggtttccgtagcaact
cctactttaccaggacaaggaatgggaggatatccatcagccatttcaacaacatatggt
accgagtactctctgagtagtgcagacctgtcatctctgtctgggtttaacaccgccagc
gctcttcaccttggttcagtaactggctggcaacagcaacacctacataacatgccacca
tctgccctcagtcagttgggagcttgcactagcactcatttatctcagagttcaaatctc
tccctgccttctactcaaagcctcaacatcaagtcagaacctgtttctcctcctagagac
cgtaccaccaccccttcgagatacccacaacacacgcgccacgaggcggggagatctcct
gttgacagcttgagcagctgtagcagttcgtacgacgggagcgaccgagaggatcaccgg
aacgaattccactcccccattggactcaccagaccttcgccggacgaaagggaaagtccc
tcagtcaagcgcatgcgactttctgaaggatgggcaacatga

DBGET integrated database retrieval system