KEGG   Pan paniscus (bonobo): 100975252Help
Entry
100975252         CDS       T02283                                 

Gene name
PRKG1
Definition
(RefSeq) protein kinase, cGMP-dependent, type I
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04022  cGMP-PKG signaling pathway
pps04270  Vascular smooth muscle contraction
pps04540  Gap junction
pps04611  Platelet activation
pps04713  Circadian entrainment
pps04714  Thermogenesis
pps04730  Long-term depression
pps04740  Olfactory transduction
pps04923  Regulation of lipolysis in adipocytes
pps04970  Salivary secretion
Module
pps_M00694  cGMP signaling
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100975252 (PRKG1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100975252 (PRKG1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100975252 (PRKG1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100975252 (PRKG1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100975252 (PRKG1)
  Digestive system
   04970 Salivary secretion
    100975252 (PRKG1)
  Nervous system
   04730 Long-term depression
    100975252 (PRKG1)
  Sensory system
   04740 Olfactory transduction
    100975252 (PRKG1)
  Environmental adaptation
   04713 Circadian entrainment
    100975252 (PRKG1)
   04714 Thermogenesis
    100975252 (PRKG1)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100975252 (PRKG1)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: AGC group
  PKG family
   100975252 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase cNMP_binding Pkinase_Tyr Med4 Kinase-like APH Pkinase_C DUF4200 Spc42p Spc7 Tsc35 PKcGMP_CC
Motif
Other DBs
NCBI-GeneID: 100975252
NCBI-ProteinID: XP_003806380
Position
10
AA seq 686 aa AA seqDB search
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQA
QKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMK
NLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKV
FGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSL
PEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLG
KGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKY
EAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEH
IRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYT
ACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYV
APEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAK
NAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKATLTPPIIPSVASPTD
TSNFDSFPEDNDEPPPDDNSGWDIDF
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccttgcgggatttacagtacgcgctccaggagaagatcgaggagctgaggcag
cgggatgctctcatcgacgagctggagctggagttggatcagaaggacgaactgatccag
aagctgcagaacgagctggacaagtaccgctcggtgatccgaccagccacccagcaggcg
cagaagcagagcgcgagcaccttgcaaggcgagccgcgcaccaagcggcaggcgatctcc
gccgagcccaccgccttcgacatccaggatctcagccatgtgaccctgcccttctacccc
aagagcccacagtccaaggatcttataaaggaagctatccttgacaatgactttatgaag
aacttggagctgtcacagatccaggagattgtggattgtatgtacccggtggagtatggc
aaggacagttgcatcatcaaagaaggagacgtggggtcactggtgtatgtcatggaagat
ggtaaggttgaagttacaaaagaaggtgtgaagttgtgtaccatgggtccaggaaaagtg
tttggggaattggctattctttacaactgtacccggacagcgaccgtcaagactcttgta
aatgtaaaactctgggccattgatcgacaatgttttcaaacaataatgatgaggacagga
ctcatcaagcataccgagtatatggaatttttaaaaagtgttccaacattccagagcctt
cctgaagagatcctcagcaagctcgctgatgtccttgaagagacccactatgaaaatgga
gaatatattatcaggcaaggtgcaagaggggacaccttctttatcatcagcaaaggaacg
gtaaatgtcactcgtgaagactcaccgagtgaagacccagtctttcttagaactttagga
aaaggagactggtttggagagaaagccttgcagggggaagatgtgagaacagcaaacgta
attgctgcagaagctgtaacctgccttgtgattgacagagactctttcaaacatttgatt
ggagggctggatgatgtttctaataaagcatatgaagatgcagaagctaaagcaaaatat
gaagctgaagcggctttcttcgccaacctgaagctgtctgatttcaacatcattgatacc
cttggagttggaggtttcggacgagtagaactggtccagttgaaaagtgaagaatccaaa
acgtttgcaatgaagattctcaagaaacgtcacattgtggacacaagacagcaggagcac
atccgctcagagaagcagatcatgcagggggctcattccgatttcatagtaagactgtac
agaacatttaaggacagcaaatatttgtatatgttgatggaagcttgtctaggtggagag
ctctggaccattctcagggatagaggttcgtttgaagattctacaaccagattttacaca
gcatgtgtggtagaagcttttgcctatctgcattccaaaggaatcatttacagggacctc
aagccagaaaatctcatcctagatcaccgaggttatgccaaactggttgattttggcttt
gcaaagaaaataggatttggaaagaaaacatggactttttgtgggactccagagtatgta
gccccagagatcatcctgaacaaaggccatgacatttcagccgactactggtcactggga
atcctaatgtatgaactcctgactggcagcccacctttctcaggcccagatcctatgaaa
acctataacatcatattgagggggattgacatgatagaatttccaaagaagattgccaaa
aatgctgctaatttaattaaaaaactatgcagggacaatccatcagaaagattagggaat
ttgaaaaatggagtaaaagacattcaaaagcacaaatggtttgagggctttaactgggaa
ggcttaagaaaagctaccttgacacctcctataataccaagtgttgcatcacccacagac
acaagtaattttgacagtttccctgaggacaacgatgaaccaccacctgatgacaactca
ggatgggatatagacttctaa

DBGET integrated database retrieval system