KEGG   Pan paniscus (bonobo): 100975326Help
Entry
100975326         CDS       T02283                                 

Definition
(RefSeq) glutathione S-transferase A2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00480  Glutathione metabolism
pps00980  Metabolism of xenobiotics by cytochrome P450
pps00982  Drug metabolism - cytochrome P450
pps00983  Drug metabolism - other enzymes
pps01524  Platinum drug resistance
pps05200  Pathways in cancer
pps05204  Chemical carcinogenesis
pps05225  Hepatocellular carcinoma
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100975326
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100975326
   00982 Drug metabolism - cytochrome P450
    100975326
   00983 Drug metabolism - other enzymes
    100975326
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100975326
   05204 Chemical carcinogenesis
    100975326
   05225 Hepatocellular carcinoma
    100975326
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100975326
  Drug resistance
   01524 Platinum drug resistance
    100975326
Enzymes [BR:pps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100975326
Transporters [BR:pps02000]
 Other Transporters
  Pores ion channels [TC:1]
   100975326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_3
Motif
Other DBs
NCBI-GeneID: 100975326
NCBI-ProteinID: XP_003833196
Position
6
AA seq 222 aa AA seqDB search
MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFSQPEEQDAK
LALIKEKTKNRYFPAFEKVLKTHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDAKSLEESRKIFRF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagcccaagctccactactccaatatacggggcagaatggagtccatccgg
tggctcctggctgcagctggagtagagtttgaagagaaatttataaaatctgcagaagat
ttggacaagttaagaaatgatggatatttgatgttccagcaagtgccaatggttgagatt
gacgggatgaagctggtgcagaccagagccattctcaactacattgccagcaaatacaac
ctctatgggaaagacataaaggagaaagccctgattgatatgtatatagaaggtatagca
gatttgggtgaaatgatccttcttctgccctttagtcaacctgaggaacaagatgccaag
cttgccttgatcaaagagaaaacaaaaaatcgctacttccctgcctttgaaaaagtctta
aagacccatggacaagactaccttgttggcaacaagctgagccgggctgacattcacctg
gtggaacttctctactacgtggaagagcttgactcgagtcttatctccagcttccctctg
ctgaaggccctgaaaaccagaatcagtaacctgcccacagtgaagaagtttctacagcct
ggcagcccaaggaagcctcccatggatgcaaaatctttagaagaatcaaggaagattttc
aggttttaa

DBGET integrated database retrieval system