KEGG   Pan paniscus (bonobo): 100975410
Entry
100975410         CDS       T02283                                 

Gene name
CD40LG, CD40L
Definition
(RefSeq) CD40 ligand
  KO
K03161  tumor necrosis factor ligand superfamily member 5
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04064  NF-kappa B signaling pathway
pps04514  Cell adhesion molecules
pps04660  T cell receptor signaling pathway
pps04672  Intestinal immune network for IgA production
pps05144  Malaria
pps05145  Toxoplasmosis
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05322  Systemic lupus erythematosus
pps05330  Allograft rejection
pps05340  Primary immunodeficiency
pps05416  Viral myocarditis
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100975410 (CD40LG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100975410 (CD40LG)
   04514 Cell adhesion molecules
    100975410 (CD40LG)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100975410 (CD40LG)
   04672 Intestinal immune network for IgA production
    100975410 (CD40LG)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    100975410 (CD40LG)
   05145 Toxoplasmosis
    100975410 (CD40LG)
  09163 Immune disease
   05310 Asthma
    100975410 (CD40LG)
   05322 Systemic lupus erythematosus
    100975410 (CD40LG)
   05320 Autoimmune thyroid disease
    100975410 (CD40LG)
   05330 Allograft rejection
    100975410 (CD40LG)
   05340 Primary immunodeficiency
    100975410 (CD40LG)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100975410 (CD40LG)
   05416 Viral myocarditis
    100975410 (CD40LG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100975410 (CD40LG)
   04090 CD molecules [BR:pps04090]
    100975410 (CD40LG)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Tumor necrosis fators
   100975410 (CD40LG)
CD molecules [BR:pps04090]
 Proteins
  100975410 (CD40LG)
SSDB
Motif
Pfam: TNF DUF5677
Other DBs
NCBI-GeneID: 100975410
NCBI-ProteinID: XP_003812370
UniProt: A0A2R9CD52
Position
X
AA seq 261 aa
MIETYNQPSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKGDQNP
QIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSN
REASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVN
VTDPSQVSHGTGFTSFGLLKL
NT seq 786 nt   +upstreamnt  +downstreamnt
atgatcgaaacatacaaccaaccttctccccgatctgcggccactggactgcccatcagc
atgaaaatttttatgtatttacttactgtttttcttatcacccagatgattgggtcagca
ctttttgctgtgtatcttcatagaaggttggacaagatagaagatgaaaggaatcttcat
gaagattttgtattcatgaaaacgatacagagatgcaacacaggagaaagatccttatcc
ttactgaactgcgaggagattaaaagccagtttgaaggctttgtgaaggatataatgtta
aacaaagaggagacgaagaaagaaaacagctttgaaatgcaaaaaggtgatcagaatcct
caaattgcggcacatgtcataagtgaggccagcagtaaaacaacatctgtgttacagtgg
gctgaaaaaggatactacaccatgagcaacaacttggtaaccctggaaaatgggaaacag
ctgaccgttaaaagacaaggactctattatatctatgcccaagtcaccttctgttccaat
cgggaagcttcgagtcaagctccatttatagccagcctctgcctaaagtcccccggtaga
ttcgagagaatcttactcagagctgcaaatacccacagttccgccaaaccttgcgggcaa
caatccattcacttgggaggagtatttgaattgcaaccaggtgcttcggtgtttgtcaat
gtgactgatccaagccaagtgagccatggcactggcttcacgtcctttggcttactcaaa
ctctga

DBGET integrated database retrieval system