KEGG   Pan paniscus (bonobo): 100975411Help
Entry
100975411         CDS       T02283                                 

Gene name
PPARA
Definition
(RefSeq) peroxisome proliferator activated receptor alpha
  KO
K07294  peroxisome proliferator-activated receptor alpha
Organism
pps  Pan paniscus (bonobo)
Pathway
pps03320  PPAR signaling pathway
pps04024  cAMP signaling pathway
pps04920  Adipocytokine signaling pathway
pps04922  Glucagon signaling pathway
pps04931  Insulin resistance
pps04932  Non-alcoholic fatty liver disease (NAFLD)
pps05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100975411 (PPARA)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100975411 (PPARA)
   04920 Adipocytokine signaling pathway
    100975411 (PPARA)
   03320 PPAR signaling pathway
    100975411 (PPARA)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100975411 (PPARA)
   04931 Insulin resistance
    100975411 (PPARA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100975411 (PPARA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100975411 (PPARA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pps03310]
    100975411 (PPARA)
Transcription factors [BR:pps03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    100975411 (PPARA)
Nuclear receptors [BR:pps03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   100975411 (PPARA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 100975411
NCBI-ProteinID: XP_003812430
UniProt: A0A2R9BY52
Position
22
AA seq 467 aa AA seqDB search
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSC
PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI
FLFPKLLQKMADLRQLVTEHAQLVQIIKKESDAALHPLLQEIYRDMY
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggtggacacggaaagcccactctgccccctctccccactcgaggctggcgatctagag
agcccgttatctgaagagttcctgcaagaaatgggaaacatccaagagatttcgcaatcc
atcggcgaggatagttctggaagctttggctttacggaataccagtatttaggaagctgt
cctggctcagatggctcggtcatcacggacacgctttcaccagcttcgagcccctcctcg
gtgacttatcctgtggtccccggcagcgtggacgagtctcccagtggagcattgaacatc
gaatgtagaatctgcggggacaaggcctcaggctaccattacggagtccacgcgtgtgaa
ggctgcaagggcttctttcggcgaacgattcgactcaagctggtgtatgacaagtgcgac
cgcagctgcaagatccagaaaaagaacagaaacaaatgccagtattgtcgatttcacaag
tgcctttctgtcgggatgtcacacaacgcgattcgttttggacgaatgccgagatctgag
aaagcaaaactgaaagcagaaattcttacctgcgaacatgacatagaagattctgaaact
gcagatctcaaatctctggccaagagaatctacgaggcctacttgaagaacttcaacatg
aacaaggtcaaagcccgggtcatcctctcaggaaaggccagtaacaatccaccttttgtc
atacatgatatggagacactgtgtatggctgagaagacgctggtggccaagctggtggcc
aatggcatccagaacaaggaggcggaggtccgcatctttcactgctgccagtgcacgtca
gtggagaccgtcacggagctcacggaattcgccaaggccatcccaggcttcgcaaacttg
gacctgaacgatcaagtgacattgctaaaatacggagtttatgaggccatattcgccatg
ctgtcttctgtgatgaacaaagacgggatgctggtggcgtatggaaatgggtttataact
cgtgaattcctaaaaagcctaaggaaaccgttctgtgatatcatggaacccaagtttgat
tttgccatgaagttcaatgcactggaactggatgacagtgatatctcccttttcgtggct
gctatcatttgctgtggagatcgtcctggccttctaaacgtaggacacattgaaaaaatg
caggagggtattgtacatgtgctcagactccacctgcagagcaaccacccggacgatatc
tttctcttcccaaaacttcttcaaaaaatggcagacctccggcagctggtgacggagcat
gcgcagctggtgcagatcatcaagaaggagtcggatgctgcgctgcacccgctactgcag
gagatctacagggacatgtactga

DBGET integrated database retrieval system