KEGG   Pan paniscus (bonobo): 100975430
Entry
100975430         CDS       T02283                                 

Gene name
TNFSF13B
Definition
(RefSeq) tumor necrosis factor superfamily member 13b
  KO
K05476  tumor necrosis factor ligand superfamily member 13B
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04064  NF-kappa B signaling pathway
pps04672  Intestinal immune network for IgA production
pps05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100975430 (TNFSF13B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100975430 (TNFSF13B)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100975430 (TNFSF13B)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100975430 (TNFSF13B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100975430 (TNFSF13B)
   04090 CD molecules [BR:pps04090]
    100975430 (TNFSF13B)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Tumor necrosis fators
   100975430 (TNFSF13B)
CD molecules [BR:pps04090]
 Proteins
  100975430 (TNFSF13B)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 100975430
NCBI-ProteinID: XP_003832128
UniProt: A0A2R8ZQJ1
Position
13
AA seq 285 aa
MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCC
LTVVSFYQVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP
GEGNSSQSSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEE
KENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETL
PNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
NT seq 858 nt   +upstreamnt  +downstreamnt
atggatgactccacagaaagggagcagtcacgccttacttcttgccttaagaaaagagaa
gaaatgaaactgaaggagtgtgtttccatcctcccacggaaggaaagcccctctgtccga
tcctccaaagacggaaagctgctggctgcaaccttgctgctggcactgctgtcttgctgc
ctcacggtggtgtctttctaccaggtggccgccctgcaaggggacctggccagcctccgg
gcagagctgcagggccaccacgcggagaagctgccagcaggagcaggagcccccaaggcc
ggcctggaggaagctccagctgtcaccgcgggactgaaaatctttgaaccaccagctcca
ggagaaggcaactccagtcagagcagcagaaataagcgtgccgttcagggtccagaagaa
acagtcactcaagactgcttgcaactgattgcagacagtgaaacaccaactatacaaaaa
ggatcttacacatttgttccatggcttctcagctttaaaaggggaagtgccctagaagaa
aaagagaataaaatattggtcaaagaaactggttacttttttatatatggtcaggtttta
tatactgataagacctacgccatgggacacctaattcagaggaagaaggtccatgtcttt
ggggatgaattgagtctggtgactttgtttcgatgtattcaaaatatgcctgaaacacta
cccaataattcctgctattcagctggcattgcaaaactggaagaaggagatgaactccaa
cttgcaataccaagagaaaatgcacaaatatcactggatggagatgtcacattttttggt
gcattgaaactgctgtga

DBGET integrated database retrieval system