KEGG   Pan paniscus (bonobo): 100975632
Entry
100975632         CDS       T02283                                 

Gene name
EGF
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04066  HIF-1 signaling pathway
pps04068  FoxO signaling pathway
pps04072  Phospholipase D signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04510  Focal adhesion
pps04540  Gap junction
pps04630  JAK-STAT signaling pathway
pps04810  Regulation of actin cytoskeleton
pps05160  Hepatitis C
pps05165  Human papillomavirus infection
pps05200  Pathways in cancer
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05219  Bladder cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05226  Gastric cancer
pps05231  Choline metabolism in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100975632 (EGF)
   04012 ErbB signaling pathway
    100975632 (EGF)
   04014 Ras signaling pathway
    100975632 (EGF)
   04015 Rap1 signaling pathway
    100975632 (EGF)
   04630 JAK-STAT signaling pathway
    100975632 (EGF)
   04066 HIF-1 signaling pathway
    100975632 (EGF)
   04068 FoxO signaling pathway
    100975632 (EGF)
   04020 Calcium signaling pathway
    100975632 (EGF)
   04072 Phospholipase D signaling pathway
    100975632 (EGF)
   04151 PI3K-Akt signaling pathway
    100975632 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100975632 (EGF)
   04540 Gap junction
    100975632 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100975632 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100975632 (EGF)
   05231 Choline metabolism in cancer
    100975632 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100975632 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100975632 (EGF)
   05212 Pancreatic cancer
    100975632 (EGF)
   05226 Gastric cancer
    100975632 (EGF)
   05214 Glioma
    100975632 (EGF)
   05218 Melanoma
    100975632 (EGF)
   05219 Bladder cancer
    100975632 (EGF)
   05215 Prostate cancer
    100975632 (EGF)
   05213 Endometrial cancer
    100975632 (EGF)
   05224 Breast cancer
    100975632 (EGF)
   05223 Non-small cell lung cancer
    100975632 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100975632 (EGF)
   05165 Human papillomavirus infection
    100975632 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100975632 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100975632 (EGF)
Cytokines and growth factors [BR:pps04052]
 Growth factors
  Growth factors (RTK binding)
   100975632 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF cEGF EGF_CA EGF_3 DUF5050
Other DBs
NCBI-GeneID: 100975632
NCBI-ProteinID: XP_003830069
UniProt: A0A2R8Z6N6
Position
4
AA seq 1207 aa
MLLTLIILLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRID
TEGTNYEQLVVDAGVSVIMDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSG
MAINWINEEVIWSNQQEGIITVTDMKGNNSHILLSALKYPANVAVDPVERFIFWSSEVAG
SLYRADLDGVGVKALLETSEKITAVSLDVLDKRLFWIQYNREGSNSLICSCDYDGGSVHI
SKHPTQHNLFAMSLFGDRIFYSTWKMKTIWIANKHTGKDMVRINLHSSFVPLGELKVVHP
LAQPKAEDDTWEPEQKLRKLRKGNCSSTVCGQDLQSHLCTCAEGYALSRDRKYCEDVNEC
AFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPSNVSECSHDCVLTSEGPL
CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCIPLSPVSWECDCFPGYDLQLDKKSCAASG
PQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRSDLNGKRSKIIAKENLSQP
RGIAIHPMAKRLFWTDTGINPRIESSSLQGLGRLIIASSDLIWPSGITIDFLTDKLYWCD
AKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVIRVNKRTGKDRVR
LQGSMLKPSSLVVVHPLVKPGADPCLYQNGGCEHICKKRLGTAWCSCREGFMKASDGKTC
LALDGHQLLAGGEVDLKNQVTPLDILSQTRVSEDNITESQHMLVAEIMVSDQDDCAPVGC
STYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCS
EGYQGDGIHCLDIDECQLGVHSCGENASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHL
REDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW
ELRHAGHGQQQKVIVVAVCVVVLVVLLLLSLWGAHYYRTQKLLSKNPKNPYEESSRDVRS
RRPADTEDGMSSCPQPWFVVIKEHQDLKNGGQPVAGEDGQAADGSMQPTSWRQEPRLCGM
GTEQGCWIPVSSDKGSCPQVMERSFHMPSYGTQTLEGGVEKPHSLLSANPLWQQRALDPP
HQMELTQ
NT seq 3624 nt   +upstreamnt  +downstreamnt
atgctgctcactcttatcattctgttgccagtagtttcaaaatttagttttgttagtctc
tcagcaccgcagcactggagctgtcctgaaggtactcttgcaggaaatgggaattctact
tgtgtgggtcctgcacccttcttaattttctcccacggaaatagtatctttaggattgac
acagaaggaaccaattatgagcaattggtggtggatgctggtgtctcagtgatcatggat
tttcattataatgagaaaagaatctattgggtggatttagaaagacaacttttgcaaaga
gtttttctgaatgggtcaaggcaagagagagtatgtaatatagagaaaaatgtttctgga
atggcaataaattggataaatgaagaagttatttggtcaaatcaacaggaaggaatcatt
acagtaacagatatgaaaggaaataattcccacattcttttaagtgctttaaaatatcct
gcaaatgtagcagttgatccagtagaaaggtttatattttggtcttcagaggtggctgga
agcctttatagagcagatctcgatggtgtgggagtgaaggctctgttggagacatcagag
aaaataacagctgtgtcattggatgtgcttgataagcggctgttttggattcagtacaac
agagaaggaagcaattctcttatttgctcctgtgattatgatggaggttctgtccacatt
agtaaacatccaacacagcataatttgtttgcaatgtccctttttggtgaccgtatcttc
tattcaacatggaaaatgaagacaatttggatagccaacaaacacactggaaaggacatg
gttagaattaacctccattcatcatttgtaccacttggtgaactgaaagtagtgcatcca
cttgcacaacccaaggcagaagatgacacttgggagcctgagcagaaacttcgcaaattg
aggaaaggaaactgcagcagcactgtgtgtgggcaagacctccagtcacacttgtgcacg
tgtgcagagggatacgccctaagtcgagaccggaagtactgtgaagatgttaatgaatgc
gctttttggaatcatggctgtactcttgggtgtaaaaacacccctggatcctattactgc
acatgccctgtaggatttgttctgcttcctgatgggaaacgatgtcatcaacttgtttcc
tgtccaagcaatgtgtctgaatgcagccatgactgtgttctgacatcagaaggtccctta
tgtttctgtcctgaaggctcggtgcttgagagagatgggaaaacatgtagcggttgttcc
tcacctgataatggtggatgtagccagctctgcattcctcttagcccagtatcctgggaa
tgtgattgctttcctgggtatgacctacaactggataaaaaaagctgtgcagcttcagga
ccacaaccatttttgctgtttgccaattctcaagatattcgacacatgcattttgatgga
acagactatggaactctgctcagccagcagatgggaatggtttatgccctagatcatgac
cctgtggaaaataagatatactttgcccatacagccctgaagtggatagagagagctaat
atggatggttcccagcgagaaaggcttattgaggaaggagtagatgtgccagaaggtctt
gctgtggactggattggccgtagattctattggacagacagagggaaatctctgattgga
aggagtgacttaaatgggaaacgttccaaaataatcgctaaggagaacctctctcaacca
cgaggaattgctattcatccaatggccaagagattattctggactgatacagggattaat
ccacgaattgaaagttcttccctccaaggccttggccgactgattatagccagctctgat
ctaatctggcccagtggaataacgattgacttcttaactgacaagttgtattggtgcgat
gccaagcagtctgtgattgaaatggccaatctggatggttcaaaacgccgaagacttacc
cagaatgatgtaggtcacccatttgctgtagcagtgtttgaggattatgtgtggttctca
gattgggctatgccatcagtaataagagtaaacaagaggactggcaaagatagagtacgt
ctccaaggcagcatgctgaagccctcatcactggttgtggttcatccattggtaaaacca
ggagcagatccctgcttatatcaaaatggaggctgtgaacatatttgcaaaaagaggctt
ggaactgcttggtgttcgtgtcgtgaaggttttatgaaagcctcagatgggaaaacgtgt
ctggctctggatggtcatcagctgttggcaggtggtgaagttgatctaaagaaccaagta
acaccattggacatcttgtcccagactagagtgtcagaagataacattacagaatctcaa
cacatgctagtggctgaaatcatggtgtcagatcaagatgactgtgctcctgtgggatgc
agcacgtatgctcggtgtatttcagagggagaggatgccacatgtcagtgtttgaaagga
tttgctggggatggaaaactatgttctgatatagatgaatgtgagatgggtgtcccagtg
tgcccccctgcctcctccaagtgcatcaacaccgaaggtggttatgtctgccggtgctca
gaaggctaccaaggagatgggattcactgtctcgatattgatgagtgccaactgggggtg
cacagctgtggagagaatgccagctgcacaaatacagagggaggctatacctgcatgtgt
gctggacgcctgtctgaaccaggactgatttgccctgactctactccaccccctcacctc
agggaagatgaccaccactattccgtaagaaatagtgactctgaatgtcccctgtcccac
gatgggtactgcctccatgatggtgtgtgcatgtatattgaagcattggacaagtatgca
tgcaactgtgttgttggctacatcggggagcgatgtcagtaccgagacctgaagtggtgg
gaactgcgccacgctggccacgggcagcagcagaaggtcatcgtggtggctgtctgcgtg
gtggtgcttgtcgtgctgctcctcctgagcctgtggggggcccactactacaggactcag
aagctgctatcgaaaaacccaaagaatccttatgaggagtcgagcagagacgtgaggagt
cgcaggcctgctgacactgaggatgggatgtcctcttgccctcaaccttggtttgtggtt
ataaaagaacaccaagacctcaagaatgggggtcaaccagtggctggtgaggatggccag
gcagcagatgggtcaatgcaaccaacttcatggaggcaggagccccggttatgtggaatg
ggcacagagcaaggctgctggattccagtatccagtgataagggctcctgtccccaggta
atggagcgaagctttcatatgccctcttatgggacacagacccttgaagggggtgtcgag
aagccccattctctcctatcagctaacccattatggcaacaaagggccctggacccacca
catcaaatggagctgactcagtga

KEGG   Pan paniscus (bonobo): 100984583
Entry
100984583         CDS       T02283                                 

Gene name
PDGFB
Definition
(RefSeq) platelet derived growth factor subunit B
  KO
K17386  platelet-derived growth factor subunit B
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04072  Phospholipase D signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04510  Focal adhesion
pps04540  Gap junction
pps04630  JAK-STAT signaling pathway
pps04810  Regulation of actin cytoskeleton
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05200  Pathways in cancer
pps05206  MicroRNAs in cancer
pps05211  Renal cell carcinoma
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05231  Choline metabolism in cancer
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100984583 (PDGFB)
   04014 Ras signaling pathway
    100984583 (PDGFB)
   04015 Rap1 signaling pathway
    100984583 (PDGFB)
   04630 JAK-STAT signaling pathway
    100984583 (PDGFB)
   04020 Calcium signaling pathway
    100984583 (PDGFB)
   04072 Phospholipase D signaling pathway
    100984583 (PDGFB)
   04151 PI3K-Akt signaling pathway
    100984583 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100984583 (PDGFB)
   04540 Gap junction
    100984583 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100984583 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100984583 (PDGFB)
   05206 MicroRNAs in cancer
    100984583 (PDGFB)
   05231 Choline metabolism in cancer
    100984583 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    100984583 (PDGFB)
   05218 Melanoma
    100984583 (PDGFB)
   05211 Renal cell carcinoma
    100984583 (PDGFB)
   05215 Prostate cancer
    100984583 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100984583 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100984583 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100984583 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100984583 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100984583 (PDGFB)
Cytokines and growth factors [BR:pps04052]
 Growth factors
  Growth factors (RTK binding)
   100984583 (PDGFB)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100984583 (PDGFB)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 100984583
NCBI-ProteinID: XP_003821658
UniProt: A0A2R9ACQ2
Position
22
AA seq 241 aa
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL
DLNMTRSHSGGELESLARGRRSLGSLTVAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgtctctctgctgctacctgcgtctggtcagcgcc
gagggggaccccattcccgaggagctttatgagatgctgagtgaccactcgatccgctcc
tttgatgatctccaacgcctgctgcacggagaccccggagaggaagatggggccgagttg
gacctgaacatgacccgctcccactctggaggcgagctggagagcttggctcgtggaaga
aggagcctgggttccctgaccgttgctgagccggccatgatcgccgagtgcaagacgcgc
accgaggtgttcgagatctcccggcgcctcatagaccgcaccaacgccaacttcctggtg
tggccgccctgcgtggaggtgcagcgctgctccggctgctgcaacaaccgcaacgtgcag
tgccgccccacccaggtgcagctgcgacctgtccaggtgagaaagatcgagattgtgcgg
aagaagccaatctttaagaaggccacggtgacgctggaagaccacctggcatgcaagtgt
gagacagtggcagctgcacggcctgtgacccgaagcccggggggttcccaggagcagcga
gccaaaacgccccaaactcgggtgaccattcggacggtgcgagtccgccggccccccaag
ggcaagcaccggaaattcaagcacacgcatgacaagacggcactgaaggagaccctcgga
gcctag

KEGG   Pan paniscus (bonobo): 100991389
Entry
100991389         CDS       T02283                                 

Gene name
PDGFA
Definition
(RefSeq) platelet derived growth factor subunit A
  KO
K04359  platelet-derived growth factor subunit A
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04072  Phospholipase D signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04510  Focal adhesion
pps04540  Gap junction
pps04630  JAK-STAT signaling pathway
pps04810  Regulation of actin cytoskeleton
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05206  MicroRNAs in cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05231  Choline metabolism in cancer
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100991389 (PDGFA)
   04014 Ras signaling pathway
    100991389 (PDGFA)
   04015 Rap1 signaling pathway
    100991389 (PDGFA)
   04630 JAK-STAT signaling pathway
    100991389 (PDGFA)
   04020 Calcium signaling pathway
    100991389 (PDGFA)
   04072 Phospholipase D signaling pathway
    100991389 (PDGFA)
   04151 PI3K-Akt signaling pathway
    100991389 (PDGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100991389 (PDGFA)
   04540 Gap junction
    100991389 (PDGFA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100991389 (PDGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100991389 (PDGFA)
   05202 Transcriptional misregulation in cancer
    100991389 (PDGFA)
   05206 MicroRNAs in cancer
    100991389 (PDGFA)
   05231 Choline metabolism in cancer
    100991389 (PDGFA)
  09162 Cancer: specific types
   05214 Glioma
    100991389 (PDGFA)
   05218 Melanoma
    100991389 (PDGFA)
   05215 Prostate cancer
    100991389 (PDGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100991389 (PDGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100991389 (PDGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100991389 (PDGFA)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100991389 (PDGFA)
Cytokines and growth factors [BR:pps04052]
 Growth factors
  Growth factors (RTK binding)
   100991389 (PDGFA)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100991389 (PDGFA)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 100991389
NCBI-ProteinID: XP_008971359
Position
7
AA seq 192 aa
MAGAVRGCAARCLFPSGSQSWSVGSAAGQAQGTAHGPGAFTVLSFTVPAGSEDSLDTSLR
VHGVHATKHAPEKRPLPIRRKRSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCV
EVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSL
NPDYREEDTDVR
NT seq 579 nt   +upstreamnt  +downstreamnt
atggcaggagctgtgaggggctgtgccgccaggtgcctgttccccagtggctcccaaagc
tggtctgtgggaagtgcggctggacaggcccagggcacagcgcacgggcctggagcattc
acggtgctctccttcacggtgcctgcagggagtgaggattctttggacaccagcctgaga
gttcacggggtccacgccactaagcatgcgcccgagaagcggcccctgcccattcgaagg
aagagaagcatcgaggaagctgtccccgctgtctgcaagaccaggacggtcatttacgag
attcctcggagtcaggtcgaccccacatccgccaacttcctgatctggcccccgtgcgtg
gaggtgaaacgctgcaccggctgctgcaacacgagcagtgtcaagtgccagccctcccgt
gtccaccaccgcagcgtcaaggtggccaaggtggaatacgtcaggaagaagccaaaatta
aaagaagtccaggtgaggttagaggagcatttggagtgcgcctgcgcgaccaccagcctg
aatccggattatcgggaagaggacacggatgtgaggtga

DBGET integrated database retrieval system