KEGG   Pan paniscus (bonobo): 100975737Help
Entry
100975737         CDS       T02283                                 

Gene name
ERN1
Definition
(RefSeq) endoplasmic reticulum to nucleus signaling 1
  KO
K08852  serine/threonine-protein kinase/endoribonuclease IRE1 [EC:2.7.11.1 3.1.26.-]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04140  Autophagy - animal
pps04141  Protein processing in endoplasmic reticulum
pps04210  Apoptosis
pps04932  Non-alcoholic fatty liver disease (NAFLD)
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100975737 (ERN1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100975737 (ERN1)
  09143 Cell growth and death
   04210 Apoptosis
    100975737 (ERN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100975737 (ERN1)
   05012 Parkinson disease
    100975737 (ERN1)
   05016 Huntington disease
    100975737 (ERN1)
   05017 Spinocerebellar ataxia
    100975737 (ERN1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100975737 (ERN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100975737 (ERN1)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100975737 (ERN1)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     100975737 (ERN1)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: Other
  IRE family
   100975737 (ERN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Ribonuc_2-5A Pkinase_Tyr PQQ_2 Pkinase_fungal PQQ APH Kdo CytochromB561_N
Motif
Other DBs
NCBI-GeneID: 100975737
NCBI-ProteinID: XP_003811410
UniProt: A0A2R9AFY5
Position
17
AA seq 977 aa AA seqDB search
MPARRLLLLLTLLLPGLGIFGSTSTVTLPETLLFVSTLDGSLHAVSKRTGSIKWTLKEDP
VLQVPTHVEEPAFLPDPNDGSLYTLGSKNNEGLMKLPFTIPELVQASPCRSSDGILYMGK
KQDIWYVIDLLTGEKQQTLSSAFADSLCPSTSLLYLGRTEYTITMYDTKTRELRWNATYF
DYAASLPEDDVDYKMSHFVSNGDGLVVTVDSESGDVLWIQNYASPVVAFYVWQREGLRKV
MHINVAVETLRYLTFMSGEVGRITKWKYPFPKETEAKSKLTPTLYVGKYSTSLYASPSMV
HEGVAVVPRGSTLPLLEGPQTDGVTIGDKGECVITPSTDVKFDPRLKSKNKLNYLRNYWL
LIGHHETPLSASTKMLERFPNNLPKHRENVIPADSEKKSFEEVINLVDQTSENAPTTVSR
DVEEKPAHAPARPEAPVDSMLKDMATIILSTFLLIGWVAFIITYPLSMHQQQQLQHQQFQ
KELEKIQLLQQQQQQLPFHPPGDTAQDSELLDTSGPYSESSGTSSPSTSPRASNHSLCSG
SSASKAGSSPSLEQDDGDEETSVVIVGKISFCPKDVLGHGAEGTIVYRGMFDNRDVAVKR
ILPECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYIAIELCAATLQEYVEQKDFAH
LGLEPITLLQQTTSGLAHLHSLNIVHRDLKPHNILISMPNAHGKIKAMISDFGLCKKLAV
GRHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFGKSLQ
RQANILLGACSLDCLHPEKHEDVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQLQ
FFQDVSDRIEKESLDGPIVKQLERGGRAVVKMDWRENITVPLQTDLRKFRTYKGGSVRDL
LRAMRNKKHHYRELPAEVRETLGSLPDDFVCYFTSRFPHLLAHTYRAMELCSHERLFQPY
YFHEPPEPQPPVTPDAL
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccggcggctgctgctgctgctgacgctgctgctgcccggcctcgggattttt
ggaagtaccagcacagtgacgcttcctgaaaccttgttgtttgtgtcaacgctggatgga
agtttgcatgctgtcagcaagaggacaggctcaatcaaatggactttaaaagaagatcca
gtcctgcaggtcccaacacatgtggaagagcctgcctttctcccagatcctaatgatggc
agcctgtatacgcttggaagcaagaataatgaaggcctgatgaaacttccttttaccatc
ccagaattggtgcaggcatccccgtgccgaagttcagatggaatcctctacatgggtaaa
aagcaggacatctggtatgttattgacctcctgactggggagaagcagcagactttgtca
tcggcctttgcagatagtctctgcccatcaacctctcttctgtatcttgggcgaacagaa
tacaccatcaccatgtacgacaccaaaactcgagagctccggtggaatgccacctacttt
gactatgcggcctcgctgcctgaggacgacgtggactacaagatgtcccactttgtgtcc
aatggtgatgggctggtggtgactgtggacagtgaatctggggacgtcctgtggatccaa
aactacgcctcccctgtggtggccttttatgtctggcagcgggagggtctgaggaaggtg
atgcacatcaatgtcgctgtggagaccctgcgctatctgaccttcatgtctggggaggtg
gggcgcatcacaaagtggaagtacccattccccaaggagacagaggccaagagcaagctg
acgcccactctgtatgttgggaaatactctaccagcctctatgcctctccctcaatggta
cacgagggggttgctgttgtgccccgcggcagcacacttcctttgctggaagggccccag
actgatggcgtcaccattggggacaagggggagtgtgtgatcacgcccagcacggacgtc
aagtttgatcccagactcaaaagcaagaacaagctcaactacttgaggaattactggctt
ctgataggacaccatgaaaccccactgtctgcgtctaccaagatgctggagagatttccc
aacaatctacccaaacatcgggaaaatgtgattcctgctgattcagagaaaaagagcttt
gaggaagttatcaacctggttgaccagacttcagaaaacgcacctaccaccgtgtctcgg
gatgtggaggagaagcccgcccatgcccctgcccggcccgaggcccccgtggactccatg
cttaaggacatggctaccatcatcctgagcaccttcctgctgattggctgggtggccttc
atcatcacctatcccctgagcatgcatcagcagcagcagctgcagcaccagcagttccag
aaggaactggagaagatccagctcctgcagcagcagcagcagcagctgcccttccaccca
cctggagacacggctcaggacagcgagctcctggacacgtctggcccatactcagagagc
tcgggcaccagcagccccagcacatcccccagggcctccaaccactcgctctgctctggc
agctctgcctccaaggctggcagcagcccctccctggaacaagacgatggagatgaggaa
accagcgtggtgatagttgggaaaatttccttctgtcccaaggatgtcctgggccatgga
gctgagggcacaattgtgtaccggggcatgtttgacaaccgcgacgtggccgtgaagagg
atcctccccgagtgttttagcttcgcagaccgtgaggtccagctgttgcgagaatcggat
gagcacccgaacgtgatccgctacttctgcacggagaaggaccggcaattccagtacatt
gccatcgagctgtgtgcagccaccctgcaagagtatgtggagcagaaggactttgcgcat
ctcggcctggagcccatcaccttgctgcagcagaccacctcgggcctggcccacctccac
tccctcaacatcgttcacagagacctaaagccacacaacattctcatatccatgcccaat
gcacacggcaagatcaaggccatgatctccgactttggcctctgcaagaagctggcagtg
ggcagacacagtttcagccgccgatctggggtgcctggcacagaaggctggatcgctcca
gagatgctgagcgaagactgtaaggagaaccctacctacacggtggacatcttttctgca
ggctgcgtcttttactacgtaatctctgagggcagccacccttttggcaagtccctgcag
cggcaggccaacatcctcctgggtgcctgcagccttgactgcttgcacccagagaagcac
gaagacgtcattgcacgtgaattgatagagaagatgattgcgatggatcctcagaaacgc
ccctcagcgaagcacgtgctcaaacacccgttcttctggagcctagagaagcagctccag
ttcttccaggacgtgagcgacagaatagaaaaggaatccctggatggcccgatcgtgaag
cagttggagagaggcgggagagccgtggtgaagatggactggcgggagaacatcactgtc
cccctccagacagacctgcgtaaattcaggacctataaaggtggttctgtcagagatctc
ctccgagccatgagaaataagaagcaccactaccgggagctgcctgcagaggtgcgggag
acgctggggtccctccccgacgacttcgtgtgctacttcacatctcgcttcccccacctc
ctcgcacacacctaccgggccatggagctgtgcagccacgagagactcttccagccctac
tacttccacgagcccccagagccccagcccccagtgactccagacgccctctga

DBGET integrated database retrieval system