KEGG   Pan paniscus (bonobo): 100975810
Entry
100975810         CDS       T02283                                 

Gene name
BIN3
Definition
(RefSeq) bridging integrator 3
  KO
K20120  bridging integrator 3
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100975810 (BIN3)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    100975810 (BIN3)
SSDB
Motif
Pfam: BAR Vps5 BAR_3 DUF4743 GCP_N_terminal DUF4665 DUF1664
Other DBs
NCBI-GeneID: 100975810
NCBI-ProteinID: XP_003823641
UniProt: A0A2R8ZYZ3
Position
8
AA seq 253 aa
MSWIPFKIGQPKKQIVPKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDADLAMSKSAV
KISLDLLSNPLCEQDQDLLNMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFGSVFPS
LNMAVKRREQALQDYRRLQAKVEKYEEKEKTGPVLAKLHQAREELRPVREDFEAKNRQLL
EEMPRFYGSRLDYFQPSFESLIRAQVVYYSEMHKIFGDLSHQLDQPGHSDEQRERENEAK
LSELRALSIVADD
NT seq 762 nt   +upstreamnt  +downstreamnt
atgagctggattccttttaaaattgggcagcccaagaaacagattgtgcccaaaacagtg
gagagagactttgaaagggagtatggaaaacttcagcagctggaagagcagacccggagg
ctgcagaaagacatgaagaagagcaccgacgccgacctggccatgtcaaaatctgccgtg
aagatatccttggacttactctccaatcccctctgtgagcaagaccaggaccttctgaac
atggtgacggccctggacacggccatgaagcggatggatgccttcaatcaggaaaaggtg
aaccagatccagaagactgtgatcgagcccttaaaaaagttcggcagtgtcttcccgagc
ctcaacatggcggtgaagaggcgggaacaggccttgcaggactacaggaggctgcaggcc
aaggtggagaagtatgaggaaaaggagaagacggggccagtgctggccaagctccaccag
gcacgagaggagctgcggcctgtacgggaggactttgaagccaagaacaggcagctgctg
gaggagatgccgcgcttctacggcagccgcctcgactacttccagcccagcttcgagtcc
ctcatccgagctcaggttgtgtactactcggaaatgcacaagatctttggagacctgtcc
catcagcttgaccagccaggccactccgatgagcagcgggagcgggagaacgaggccaaa
ctcagtgagctccgggccctctccattgtggccgatgactga

DBGET integrated database retrieval system