KEGG   Pan paniscus (bonobo): 100975910
Entry
100975910         CDS       T02283                                 

Gene name
MAF
Definition
(RefSeq) MAF bZIP transcription factor
  KO
K09035  transcription factor Maf
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04658  Th1 and Th2 cell differentiation
pps05202  Transcriptional misregulation in cancer
pps05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100975910 (MAF)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100975910 (MAF)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100975910 (MAF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100975910 (MAF)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Maf
    100975910 (MAF)
SSDB
Motif
Pfam: bZIP_Maf Maf_N bZIP_1 ZapB bZIP_2 KASH_CCD vATP-synt_E NUDE_C GAS
Other DBs
NCBI-GeneID: 100975910
NCBI-ProteinID: XP_014197353
Position
16
AA seq 245 aa
MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPM
STPCSSVPPSPSFSAPSPGSGSEQKAHLEEYYWMTGYPHDDRFSDEQLVTMSVRELNRQL
RGVSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLV
RERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLT
SVFTK
NT seq 738 nt   +upstreamnt  +downstreamnt
atggcatcagaactggcaatgagcaactccgacctgcccaccagtcccctggccatggaa
tatgttaatgacttcgatctgatgaagtttgaagtgaaaaaggaaccggtggagaccgac
cgcatcatcagccagtgcggccgtctcatcgccgggggctcgctgtcctccacccccatg
agcacgccgtgcagctcggtgcccccttcccccagcttctcggcgcccagcccgggctcg
ggcagcgagcagaaggcgcacctggaagaatactactggatgaccggctacccgcacgac
gaccgcttctccgacgagcagctggtgaccatgtctgtgcgcgagctgaaccggcagctg
cgcggggtcagcaaggaggaggtgatccggctgaagcagaagaggcggaccctgaaaaac
cgcggctatgcccagtcctgccgcttcaagagggtgcagcagagacacgtcctggagtcg
gagaagaaccagctgctgcagcaagtcgaccacctcaagcaggagatctccaggctggtg
cgcgagagggacgcgtacaaggagaaatacgagaagttggtgagcagcggcttccgagaa
aacggctcgagcagcgacaacccgtcctctcccgagtttttcataactgagcccactcgc
aagttggagccatcagtgggatacgccacattttggaagccccagcatcgtgtacttacc
agtgtgttcacaaaatga

DBGET integrated database retrieval system