KEGG   Pan paniscus (bonobo): 100976000Help
Entry
100976000         CDS       T02283                                 

Gene name
IP6K2
Definition
(RefSeq) inositol hexakisphosphate kinase 2
  KO
K07756  inositol-hexakisphosphate 5-kinase [EC:2.7.4.21]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100976000 (IP6K2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.21  inositol-hexakisphosphate kinase
     100976000 (IP6K2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPK
Motif
Other DBs
NCBI-GeneID: 100976000
NCBI-ProteinID: XP_003818444
UniProt: A0A2R8ZWR9
Position
3
AA seq 426 aa AA seqDB search
MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMR
KFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHH
VLETEKTPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEVLYYTVEKKGNISSQLKHYNPWS
MKCHQQQLQRMKENAKHRNQYKFILLENLTSRYEVPCVLDLKMGTRQHGDDASEEKAANQ
IRKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKLSVQGFKEALFQFFHNGRYLR
RELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAEDLEDLSEESA
DESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDTVVHEGQDAGYIFGLQSLIDIVTEI
SEESGE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcccagccttcagggccatggatgtggagccccgcgccaaaggcgtccttctggag
ccctttgtccaccaggtcggggggcactcatgcgtgctccgcttcaatgagacaaccctg
tgcaagcccctggtcccaagggaacatcagttctacgagaccctccctgctgagatgcgc
aaattcactccccagtacaaaggtgtggtatctgtgcgctttgaagaagatgaagacagg
aacttgtgtctaatagcatatccattgaaaggggaccatggaattgtggacattgtagat
aattcagactgtgaaccaaaaagtaagctcctaaggtggacaacaaacaaaaaacatcat
gtcttagaaacagaaaagacccctaaggactgggtgcgtcagcaccgtaaagaggagaaa
atgaagagccataagttagaagaagaatttgagtggctaaagaaatctgaagtcttgtac
tacactgtagagaagaaggggaatataagttcccagcttaaacactataacccttggagc
atgaaatgtcaccagcaacagttacagagaatgaaggagaatgcaaagcatcggaaccag
tacaaatttatcttactggaaaacctgacttcccgctacgaggtgccttgtgtccttgac
ctcaagatgggcacacgacaacatggtgatgatgcttcagaggagaaggcagccaaccag
atccgaaaatgtcagcagagcacatctgcagtcattggtgtgcgtgtgtgtggcatgcag
gtgtaccaagcaggcagtgggcaactcatgttcatgaacaagtaccatggacggaagcta
tcggtgcagggcttcaaggaggcacttttccagttcttccacaatgggcggtacctgcgc
cgtgaactcctgggccctgtgctcaagaagctgactgagctcaaggcagtgttggagcga
caggagtcctaccgcttctactcaagctccctgctggtcatctatgatggcaaggagcgg
cccgaagtggtcctggactcagatgctgaggatttggaggacctgtcagaggaatcagct
gatgagtctgctggtgcctatgcctacaaacccatcggcgccagctctgtagatgtgcgc
atgatcgactttgcacacaccacctgcaggctgtatggcgaggacactgtggtgcatgag
ggccaggatgctggctatatcttcgggctccagagcctgatagacattgtcacagagata
agtgaggagagtggggagtga

DBGET integrated database retrieval system