KEGG   Pan paniscus (bonobo): 100976001
Entry
100976001         CDS       T02283                                 

Gene name
CCR9
Definition
(RefSeq) C-C motif chemokine receptor 9
  KO
K04184  C-C chemokine receptor type 9
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04062  Chemokine signaling pathway
pps04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100976001 (CCR9)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100976001 (CCR9)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100976001 (CCR9)
   04062 Chemokine signaling pathway
    100976001 (CCR9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100976001 (CCR9)
   04050 Cytokine receptors [BR:pps04050]
    100976001 (CCR9)
   04090 CD molecules [BR:pps04090]
    100976001 (CCR9)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    100976001 (CCR9)
Cytokine receptors [BR:pps04050]
 Chemokine receptors
  CC Chemokine
   100976001 (CCR9)
CD molecules [BR:pps04090]
 Proteins
  100976001 (CCR9)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF621
Other DBs
NCBI-GeneID: 100976001
NCBI-ProteinID: XP_003818527
UniProt: A0A2R9CEE7
Position
3
AA seq 369 aa
MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFI
VGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCK
VVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALC
IPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHT
LIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQ
VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLL
ETTSGARSL
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgacacccacagacttcacaagccctattcctaacatggctgatgactatggctctgaa
tccacatcttccatggaagactacgttaacttcaacttcactgacttctactgtgagaaa
aacaatgtcaggcagtttgcgagccatttcctcccacccttgtactggctcgtgttcatc
gtgggtgccttgggcaacagtctggttatccttgtctactggtactgcacaagagtgaag
accatgaccgacatgttccttttgaatttggcaattgctgacctcctctttcttgtcact
cttcccttctgggccattgccgctgctgaccagtggaagttccagaccttcatgtgcaag
gtggtcaacagtatgtacaagatgaacttctacagctgtgtgttgctgatcatgtgcatc
agcgtggacaggtacattgccattgcccaggccatgagagcacatacttggagggagaaa
aggcttttgtacagcaaaatggtttgctttaccatctgggtattggcagctgctctctgc
atcccagaaatcttatacagccaaatcaaggaggaatccggcattgctatctgcaccatg
gtttaccctagcgacgagagcaccaaactgaagtcagctgtcttgaccctgaaggtcatt
ctggggttcttccttcccttcgtggtcatggcttgctgctacaccatcatcattcacacc
ctgatacaagccaagaagtcatccaagcacaaagccctaaaagtgaccatcactgtcctg
accgtctttgtcttgtctcagtttccctacaactgcattttgttggtgcagaccattgac
gcctatgccatgttcatctccaactgtgccgtttccaccaacattgacatctgcttccag
gtcacccagaccatcgccttcttccacagttgcctgaaccctgttctctatgtttttgtg
ggtgagagattccgccgggatcttgtgaaaaccctgaagaacttgggttgcatcagccag
gcccagtgggtttcatttacaaggagagagggaagcttgaagctgtcgtctatgttgctg
gagacaacctcaggagcacgctccctctga

DBGET integrated database retrieval system