KEGG   Pan paniscus (bonobo): 100976185
Entry
100976185         CDS       T02283                                 

Gene name
TBX21
Definition
(RefSeq) T-box 21
  KO
K10166  T-box protein 21
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100976185 (TBX21)
   04659 Th17 cell differentiation
    100976185 (TBX21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100976185 (TBX21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100976185 (TBX21)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Other transcription factors
   T-box
    100976185 (TBX21)
SSDB
Motif
Pfam: T-box T-box_assoc
Other DBs
NCBI-GeneID: 100976185
NCBI-ProteinID: XP_008951305
Position
17
AA seq 539 aa
MAVPMTAMQGRGAFVGPARPSSGPCKPLAAADAVRFKEHFLLSIRFQDADERRGGGSLGS
PYPGGALVPAPPSRFLGAYAYPPRPQAAGXPGAGESFPPPADSEGYQPGEGYAAPDPRAG
LYPGPREDYALPAGLEVSGKLRVALNNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAG
LEPTSHYRMFVDVVLVDQHHWRYQSGKWVQCGKAEGSMPGNRLYVHPDSPNTGAHWMRQE
VSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGEPEAACNASNTHIFTFQE
TQFIAVTAYQNAEITQLKIDNNPFAKGFRENFESMYTSVDTSIPSPPGPNCQFLGGDHYS
PLLPNQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPT
MSYYRGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLV
WTEIAPIRPESSDSGLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPN
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggcagtgcccatgactgccatgcagggtaggggagcttttgtgggccctgccaggccc
agctcagggccctgcaaacccctggctgctgctgatgcagtgcgctttaaggaacatttc
ctgttgtccatcaggttccaggacgcggacgagcgtcgcgggggcggcagcctggggtct
ccctacccggggggcgccttggtgcccgccccgccgagccgcttccttggagcctacgcc
tacccgccgcgaccccaggcggccggcntccccggcgcgggcgagtccttcccgccgccc
gcggactccgagggctaccagccgggcgagggctacgccgccccggacccgcgcgccggg
ctctacccggggccgcgtgaggactatgcgctacccgcggggctggaggtgtcggggaaa
ctgagggtcgcgctcaacaaccacctgttgtggtccaagtttaatcagcaccagacagag
atgatcatcaccaagcagggacggcggatgttcccattcctgtcatttactgtggccggg
ctggagcccaccagccactacaggatgtttgtggacgtggtcttggtggaccagcaccac
tggcggtaccagagcggcaagtgggtgcagtgtggaaaggccgagggcagcatgccagga
aaccgcctgtacgtccacccggactcccccaacacaggagcgcactggatgcgccaggaa
gtttcatttgggaaactaaagctcacaaacaacaagggggcgtccaacaatgtgacccag
atgattgtgctccagtccctccataagtaccagccccggctgcatatcgttgaggtgaac
gacggagagccagaggcagcctgcaacgcttccaacacgcatatctttactttccaagaa
acccagttcattgccgtgactgcctaccagaatgccgagattactcagctgaaaattgat
aataacccctttgccaaaggattccgggagaactttgagtccatgtacacatctgttgac
accagcatcccctccccgcctggacccaactgtcaattccttgggggagatcactactct
cctctcctacccaaccaatatcctgttcccagccgcttctaccccgaccttcctggccag
gcgaaggatgtggttccccaggcttactggctgggggccccccgggaccacagctatgag
gctgagtttcgagcagtcagcatgaagcctgcattcttgccctctgcccctgggcccacc
atgtcctactaccgaggccaggaggtcctggcacctggagctggctggcctgtggcaccc
cagtaccctcccaagatgggcccggccagctggttccgccctatgcggactctgcccatg
gaacctggccctggaggctcagagggacggggaccagaggaccagggtccccccttggtg
tggactgagattgcccccatccggccggaatccagtgattcaggactgggcgaaggagac
tctaagaggaggcgcgtgtccccctatccttccagtggtgacagctcctcccctgctggg
gccccttctccttttgataaggaagctgaaggacagttttataactattttcccaactga

DBGET integrated database retrieval system