KEGG   Pan paniscus (bonobo): 100976227Help
Entry
100976227         CDS       T02283                                 

Gene name
GRB7
Definition
(RefSeq) growth factor receptor bound protein 7
  KO
K23695   
Organism
pps  Pan paniscus (bonobo)
SSDB OrthologParalogGFIT
Motif
Pfam: BPS SH2 RA PH
Motif
Other DBs
NCBI-GeneID: 100976227
NCBI-ProteinID: XP_003831496
UniProt: A0A2R9AMK8
Position
17
AA seq 532 aa AA seqDB search
MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERR
ATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAA
GATARHVCEMLVQRAHALSDETWGLVECHPHLALERGLEDHESVVEVQAAWPVGGDSRFV
FRKNFAKYELFKSSPHSLFPEKMVSSCLDAHTGISHEDLIQNFLNAGSFPEIQGFLQLRG
SGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNESNVYVVTQGRKLYGMPTDFG
FCVKPNKLRNGHKGLRIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQAQSRHLHPSCLG
SPPLRSASDNTLVAMDFSGHAGRVIENPREALSVALEEAQAWRKKTNHRLSLPTPASGTS
LSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHY
LILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggagctggatctgtctccacctcatcttagcagctctccggaagacctttgcccagcc
cctgggacccctcctgggactccccggccccctgatacccctctgcctgaggaggtaaag
aggtcccagcctctcctcatcccaaccaccggcaggaaacttcgagaggaggagaggcgt
gccacctccctcccctctatccccaaccccttccctgagctctgcagtcctccctcacag
agccccattctcgggggcccctccagtgcaagggggctgctcccccgcgatgccagccgc
ccccatgtagtaaaggtgtacagtgaggatggggcctgcaggtctgtggaggtggcagca
ggtgcaacagctcgccacgtgtgtgaaatgctggtgcagcgagctcacgccttgagcgac
gagacctgggggctggtggagtgccacccccacctagcactggagcggggtttggaggac
cacgagtccgtggtggaagtgcaggctgcctggcccgtgggcggagatagccgcttcgtc
ttccggaaaaacttcgccaagtacgaactgttcaagagctccccacactccctgttccca
gaaaaaatggtctccagctgtctcgatgcacacactggtatatcccatgaagacctcatc
cagaacttcctgaatgctggcagctttcctgagatccagggctttctgcagctgcggggt
tcaggacggaagctttggaaacgctttttctgcttcttgcgccgatctggcctctattac
tctaccaagggcacctctaaggatccgaggcacctgcagtacgtggcagatgtgaacgag
tccaacgtgtacgtggtgacgcagggccgcaagctctacgggatgcccactgacttcggt
ttctgtgtcaagcccaacaagcttcgaaatggccacaaggggcttcggatcttctgcagt
gaagacgagcagagccgcacctgctggctggctgccttccgcctcttcaagtacggggtg
cagctgtacaagaattaccagcaggcacagtctcgccatctgcatccatcttgtttgggc
tccccacccttgagaagtgcctcagataataccctggtggccatggacttctctggccat
gctgggcgtgtcatcgagaacccccgggaggctctgagtgtggccctggaggaggcccag
gcctggaggaagaagacaaaccaccgcctcagcctgcccacgccagcctccggcacgagc
ctcagtgcagccatccaccgcacccaactctggttccacgggcgcatttcccgtgaggag
agccagcggcttattggacagcagggcttggtagacggccttttcctggtccgggagagt
cagcggaacccccagggctttgtcctctctttgtgtcacctgcagaaagtgaagcattat
ctcatcctgccgagcgaggaggagggccgcctgtacttcagcatggatgatggccagacc
cgcttcactgacctgctgcagctcgtggagttccaccagctgaaccgcggcatcctgccg
tgcttgctgcgccattgctgcacgcgggtggccctctga

DBGET integrated database retrieval system