KEGG   Pan paniscus (bonobo): 100976426Help
Entry
100976426         CDS       T02283                                 

Gene name
SLC9A3R1
Definition
(RefSeq) SLC9A3 regulator 1
  KO
K13365  Na(+)/H(+) exchange regulatory cofactor NHE-RF1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04530  Tight junction
pps04928  Parathyroid hormone synthesis, secretion and action
pps05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100976426 (SLC9A3R1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100976426 (SLC9A3R1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100976426 (SLC9A3R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100976426 (SLC9A3R1)
Transporters [BR:pps02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   100976426 (SLC9A3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EBP50_C PDZ_6 PDZ PDZ_2 GRASP55_65 HoxA13_N
Motif
Other DBs
NCBI-GeneID: 100976426
NCBI-ProteinID: XP_003813378
UniProt: A0A2R8ZEL3
Position
17
AA seq 358 aa AA seqDB search
MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLV
EVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREELLRAQEAPGQA
EPPAAAEAQGAGNENEPREADKSHPEQRELRPRLCTMKKGPSGYGFNLHSDKSKPGQFIR
SVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFK
KCRVTPSQEHLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQ
DSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQKRSSKRAPQMDWSKKNELFSNL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggacgcagcggccggggcgcccctgccccggctctgctgcctggagaagggt
ccgaacggctacggcttccacctgcacggggagaagggcaagttgggccagtacatccgg
ctggtggagcccggctcgccggccgagaaggcggggctgctggcgggggaccggctggtg
gaggtgaacggcgaaaacgtggagaaggagacccaccagcaggtggtgagccgcatccgc
gccgcactcaacgccgtgcgcctgctggtggtcgaccccgagacggacgagcagctgcag
aagctcggcgtccaggtccgagaggagctgctgcgcgcccaggaagcgccggggcaggcc
gagccgccggccgccgccgaggcgcagggggctggcaacgaaaatgagcctcgcgaggcc
gacaagagccacccggagcagcgcgagcttcggcctcggctctgtaccatgaagaagggc
cccagtggctatggcttcaacctgcacagcgacaagtccaagccaggccagttcatccgg
tcagtggacccagactccccggctgaggcttcagggctccgggcccaggatcgcattgtg
gaggtgaacggggtctgcatggaggggaagcagcatggggacgtggtgtccgccatcaga
gctggcggggacgagaccaagctgctggtggtggacagggaaaccgacgagttcttcaag
aaatgcagagtgaccccatctcaggagcacctgaatggtcccctgcctgtgcccttcacc
aatggggagatacagaaggagaacagtcgtgaagccctggcagaggcagccttggagagc
cccaggccagccctggtgagatccgcctccagtgacaccagcgaggagctgaattcccaa
gacagccccccaaaacaggactccacagcgccctcgtctacctcctcctccgaccccatc
ctagacttcaacatctccctggccatggccaaagagagggcccaccagaaacgcagcagc
aaacgggccccgcagatggactggagcaagaaaaacgaactcttcagcaacctctga

DBGET integrated database retrieval system