KEGG   Pan paniscus (bonobo): 100976440Help
Entry
100976440         CDS       T02283                                 

Gene name
RPTOR
Definition
(RefSeq) regulatory associated protein of MTOR complex 1
  KO
K07204  regulatory associated protein of mTOR
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04136  Autophagy - other
pps04140  Autophagy - animal
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04152  AMPK signaling pathway
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04714  Thermogenesis
pps04910  Insulin signaling pathway
pps05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100976440 (RPTOR)
   04152 AMPK signaling pathway
    100976440 (RPTOR)
   04150 mTOR signaling pathway
    100976440 (RPTOR)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100976440 (RPTOR)
   04136 Autophagy - other eukaryotes
    100976440 (RPTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100976440 (RPTOR)
  Aging
   04211 Longevity regulating pathway - mammal
    100976440 (RPTOR)
   04213 Longevity regulating pathway - multiple species
    100976440 (RPTOR)
  Environmental adaptation
   04714 Thermogenesis
    100976440 (RPTOR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100976440 (RPTOR)
Membrane trafficking [BR:pps04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100976440 (RPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Raptor_N HEAT HEAT_2 WD40 Cnd1
Motif
Other DBs
NCBI-GeneID: 100976440
NCBI-ProteinID: XP_003831186
Position
17
AA seq 1335 aa AA seqDB search
MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYHTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLVSDGSPMVR
KELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATTEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSPENEEHILS
FETIDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSIAYK
ATVNARPQRVLDTSSLTQSAPASPTNKGVHIHQAGGSPPASSTSSSSLTNDVAKQPVSRD
LPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRLDDQIFLN
RNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALS
ECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALD
IHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRVR
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgaaatgctgcaatcgcctcttctgggcctgggggaggaagatgaggctgat
cttacagactggaacctacctttggcttttatgaaaaagaggcactgtgagaaaattgaa
ggctccaaatccttagctcagagctggaggatgaaggatcggatgaagacagtcagcgtt
gccttggttttgtgcctgaatgttggtgtggaccctcccgatgtggtgaagaccacgccc
tgtgcacgcttggaatgctggatcgatcctctgtcgatgggtcctcagaaagctctggaa
accatcggtgcaaatttacagaagcagtacgagaactggcagccaagggcccggtacaag
cagagccttgacccaactgtggatgaagtcaagaagctctgcacgtccttacgtcgcaac
gccaaggaggagcgagtcctctttcactacaatggccacggggtgccccggcccacagtc
aacggggaggtctgggtcttcaacaagaactacacgcagtacatccctctgtccatatat
gacctgcagacgtggatgggcagcccgtcgatcttcgtctacgactgctccaatgctggc
ttgatcgtcaagtccttcaagcagttcgcactacagcgggagcaggagctggaggtagct
gcaatcaacccaaatcaccctcttgctcagatgcctttgcctccgtcgatgaaaaactgc
atccagctggcagcctgcgaggccaccgagctgctgcccatgatccccgacctcccggct
gacctgttcacctcctgcctcaccacccccatcaagatcgccctgcgctggttttgcatg
cagaaatgtgtcagtctggtgcctggcgtcacactggatttgatagaaaagatccctggc
cgcctgaacgacaggaggacgcccctgggtgaactgaactggatcttcacagccatcaca
gacaccatcgcgtggaacgtgctcccccgggatctcttccaaaagctcttcagacaggac
ttgctggtggctagtctgtttcgaaattttttattggcggaaaggattatgaggtcgtat
aactgcactcccgtcagcagcccgcgtctgccgcccacgtacatgcacgccatgtggcaa
gcctgggacctggctgttgacatctgtctgtctcagctgccgacgatcatcgaggaaggc
actgcgtttcggcacagcccattcttcgccgagcagctgactgcattccaggtgtggctc
accatgggcgtggagaaccgaaacccacccgaacagctgcccatcgtcctgcaggtgctg
ttaagccaagtgcaccggctgagagcattggacttgcttggaagatttttggacctgggt
ccctgggcagtgagcctggccttgtctgtcggcatcttcccctacgtgctgaagctgctc
cagagctcggcccgagagctgcggccacttctcgttttcatctgggccaagatcctcgca
gtggacagctcgtgccaggcggacctcgtgaaggacaacggccacaagtacttcctgtcg
gtcctggcggacccctacatgccagcggaacacaggaccatgacggctttcattctcgcc
gtgatcgtcaacagctatcacacggggcaggaagcctgccttcagggaaacctcattgcc
atctgcctggagcagctcaacgacccgcaccccttgcttcgccagtgggtggccatctgc
ctcggcaggatctggcagaacttcgactcggcgaggtggtgcggcgtgagggacagcgct
catgagaagctctacagcctcctctccgaccccattcccgaggtccgctgtgcggcggtc
ttcgcccttggcacgttcgtgggcaactctgcagagaggacggaccactccaccaccatc
gaccacaacgtggccatgatgctggcccagctggtcagcgacgggagccccatggtccgg
aaggagctggtggtggctctgagtcatctcgtggttcagtatgaaagcaatttctgcacc
gtggccctgcagttcatagaagaggaaaagaactacgccttgccttctccagcgaccaca
gagggagggagtttgaccccagtgcgagacagcccgtgcacccccagacttcgttctgtg
agctcctatggaaacatccgtgctgtcgccacagccaggagcctcaacaaatctttgcag
aacctgagtttgacagaggaatctggtggtgcggtggcgttctcccccggaaacctcagc
accagcagcagcgccagcagcaccctgggcagccccgagaatgaggagcatatcctgtcc
ttcgagaccatcgacaagatgcgccgcgccagctcctactcctccctcaactccctcatc
ggagtttcctttaacagtgtttacactcagatttggagagtcctgctgcacctggctgct
gacccctatccagaggtctcggacgtggccatgaaagtactcaacagcatcgcctacaag
gccaccgtgaacgcccggccgcagcgcgtcctggacacctcctccctcacgcagtcggcc
cccgccagccccaccaacaagggcgtgcacatccaccaggcggggggctcccctccggcg
tccagcaccagcagctccagcctgaccaacgatgtggccaagcagccggtcagccgagac
ttgccttctggccggccgggcaccacaggccccgctggggcgcagtacacccctcactcc
caccagttcccccggacacggaagatgttcgacaagggcccagagcagactgcggacgac
gcggacgatgctgctggacacaaaagtttcatctccgccacggtgcagacggggttctgc
gactggagcgcccgctattttgcccagcccgtcatgaagatcccagaagagcacgacctg
gagagtcagatccgcaaggagcgggagtggcggttcctgcgaaacagccgcgtcaggagg
caggcccagcaagtcattcagaagggcattacgagattggatgaccaaatatttctgaat
aggaaccccggcgtcccctctgtggtgaaattccaccccttcacgccgtgcatcgccgta
gccgacaaggacagcatctgcttttgggactgggagaaaggggagaagctggattatttc
cacaatgggaaccctcggtacacgagggtcactgccatggagtatctgaacggccaggac
tgctcgcttctgctgacagccacagacgatggtgccatcagggtctggaagaattttgct
gatttggaaaagaacccagagatggtgaccgcatggcaggggctctcggacatgctgcca
acgacacgaggagctgggatggtggtggactgggagcaggagaccggcctcctcatgagc
tcaggagacgtgcggatcgtccggatctgggacacagaccgtgagatgaaggtgcaggac
atccctacgggcgcagacagctgcgtgacgagtctgtcctgtgattcccaccgctcactc
atcgtggctggcctcggtgatggctccatccgcgtctacgacagaaggatggcactcagc
gaatgccgcgtcatgacgtaccgggagcacacagcctgggtggtgaaggcctccctgcag
aagcgtcccgacggccacatcgtgagtgtgagcgtcaacggagatgtgcgcatctttgat
ccccggatgcccgagtcggtaaatgtgcttcagatcgtgaaggggctgacggccctggac
atccacccccaggcggacctgatcgcatgtggctccgtcaatcagttcaccgccatctac
aacagcagcggagagctcatcaacaacatcaagtactacgacggcttcatgggccagcgg
gtcggcgccatcagctgcctggccttccacccgcactggcctcacctggccgtgggaagc
aacgactactacatctccgtgtactcggtggagaagcgtgtcagatag

DBGET integrated database retrieval system