KEGG   Pan paniscus (bonobo): 100976517Help
Entry
100976517         CDS       T02283                                 

Gene name
BLVRA
Definition
(RefSeq) biliverdin reductase A
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00860  Porphyrin and chlorophyll metabolism
pps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100976517 (BLVRA)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     100976517 (BLVRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biliv-reduc_cat GFO_IDH_MocA NAD_binding_3 NEXCaM_BD
Motif
Other DBs
NCBI-GeneID: 100976517
NCBI-ProteinID: XP_003808723
UniProt: A0A2R9A8I3
Position
7
AA seq 296 aa AA seqDB search
MNTEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSVDGVQQISLE
DALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKV
LHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLF
GELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLEN
VPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagagcccgagaggaagtttggcgtggtggtggttggtgttggccgagccggc
tccgtgcgaatgagggacttgcggaatccacacccttcctcagcgttcctgaacctgatt
ggcttcgtgtcgagaagggagctcgggagcgttgatggagtccagcagatttctttggag
gatgctctttccagccaagaggtggaggtcgcctatatctgcagtgagagctccagccat
gaggactacatcaggcagttccttaatgctggcaagcacgtccttgtggaataccccatg
acactgtcattggcggccgctcaggaactgtgggagctggctgagcagaaaggaaaagtc
ttgcacgaggagcatgttgaactcttgatggaggaattcgctttcctgaaaaaagaagtg
gtggggaaagacctgctgaaagggtcgctcctcttcacagctggcccgttggaagaagag
cggtttggcttccctgcattcagcggcatctctcgcctgacctggctggtctccctcttt
ggggagctttctcttgtgtctgccactttggaagagcgaaaggaagatcagtatatgaaa
atgacagtgtgtctggagacagagaagaaaagtccactgtcatggattgaagaaaaagga
cctggtctaaaacgaaacagatatttaagcttccatttcaagtctgggtccttggagaat
gtgccaaatgtaggagtgaataagaacatatttctgaaagatcaaaatatatttgtccag
aaactcttgggccagttctctgagaaggaactggctgctgaaaagaaacgcatcctgcac
tgcctggggcttgcagaagaaatccagaaatattgctgttcaaggaagtaa

DBGET integrated database retrieval system