KEGG   Pan paniscus (bonobo): 100976525Help
Entry
100976525         CDS       T02283                                 

Gene name
GUCY2D
Definition
(RefSeq) guanylate cyclase 2D, retinal
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00230  Purine metabolism
pps01100  Metabolic pathways
pps04740  Olfactory transduction
pps04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100976525 (GUCY2D)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    100976525 (GUCY2D)
   04740 Olfactory transduction
    100976525 (GUCY2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100976525 (GUCY2D)
Enzymes [BR:pps01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100976525 (GUCY2D)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   100976525 (GUCY2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA Kinase-like
Motif
Other DBs
NCBI-GeneID: 100976525
NCBI-ProteinID: XP_008960854
Position
17
AA seq 1033 aa AA seqDB search
MTACARRAGGLPDPGLCGPARWAPSLPRXPRALPRLPLLLLLLLLQPLARVSGLVGPVNP
AACRPAELLAEEAGIALVPWGCPWTQAEGTTAPAVTPAADALYALLRAFGWARVALVTAP
QDLWVEAGRSLSTALRARGLPVASVTSMEPLDLSGAREALRKVRDGPRVTAVIMVMHSVL
LGGEEQRYLLEAAEELGLTDGSLVFLPFDTIHYALSPGPEALAALANSSQLRRAHDAVLT
LTRHCPSEGSVLDSLRRAQERRELPSDLNLQQVSPLFGTIYDAVFLLARGVAEARAAAGG
RWVSGAAVARHIRDAQVPGFCGDLGGDEEPPFVLLDTDAAGDRLFATYMLDPARGSFLSA
GTRMHFPRGGSAPGPDPSCWFDPNNICGGGLEPGLVFLGFLLVVGMGLAGVFLAHYVRHR
LLHIQMVSGPNKIILTVDDITFLHPHGGTSRKVAQGSRSSLGARSMSDIRSGPSQHLDSP
NVGVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAAL
WEGNLAVVSEHCTRGSLQDLLTQREIKLDWMFKSSLLLDLIKGIRYLHHRGVAHGRLKSR
NCIVDGRFVLKITDHGHGRLLEAQKVLPEPPRAEDQLWTAPELLRDPALERRGTLAGDVF
SLAIIMQEVVCRSAPYAMLELTPEEVVQRVRSPPPLCRPLVSMDQAPVECIHLMKQCWAE
QPELRPSMDHTFDLFKNINKGRKTNIIDSMLRMLEQYSSNLEDLIRERTEELELEKQKTD
RLLTQMLPPSVAEALKTGTPVEPEYFEQVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYT
LFDAIIGSHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAVGTFRMRHMPE
VPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNLSTVGILRA
LDSGYQVELRGRTELKGKGAEDTFWLVGRRGFNKPIPKPPDLQPGSSNHGISLQEIPPER
RRKLEKARPGQFS
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctgcgcccgccgagcgggtgggcttccggaccccgggctctgcggtcccgcg
cggtgggctccgtccctgccccgcnctccccgggccctgccccggctcccgctcctgctg
ctcctgcttctgctgcagcccctggcccgcgtgtcgggcctcgtgggtccggtgaaccct
gcggcctgccggccagccgagctgctcgccgaagaagctgggatcgcgctggtgccctgg
ggctgcccctggacgcaggcggagggcaccacggcccctgccgtgacccccgccgcggat
gccctctacgccctgcttcgcgcattcggctgggcgcgcgtggccctggtcaccgccccc
caggacctgtgggtggaggcgggacgctcactgtccacggcactcagggcccggggcctg
cctgtcgcctccgtgacttccatggagcccttggacctgtctggagcccgggaggccctg
aggaaggttcgggacgggcccagggtcacagcagtgatcatggtgatgcactcggtgctg
ctgggtggcgaggagcagcgctacctcctggaggccgcagaggagctgggcctgaccgat
ggctccctggtcttcctgcccttcgacacgatccactacgccttgtccccaggcccggag
gccttggccgcactcgccaacagctcccagcttcgcagggcccacgatgccgtgctcacc
ctcacgcgccactgtccctctgaaggcagcgtgctggacagcctgcgcagggctcaagag
cgccgcgagctgccctctgacctcaatctgcagcaggtctccccactctttggcaccatc
tatgacgcggtcttcttgctggcaaggggcgtggcagaagcgcgggctgccgcgggtggc
agatgggtgtccggagcagctgtggcccgccacatccgggatgcgcaggtccctggcttc
tgcggggacctaggaggagacgaggagcccccattcgtgctgctagacacggacgcggcg
ggagaccggctttttgccacatacatgctagatcctgcccggggctccttcctctccgcc
ggtacacggatgcacttcccacgtgggggatcagcacccggacctgacccctcgtgctgg
ttcgatccaaacaacatctgcggtggaggactggagccgggcctcgtctttcttggcttc
ctcctggtggttgggatggggctggctggggtcttcctggcccattatgtgaggcaccgg
ctacttcacattcaaatggtctccggccccaacaagatcatcctgaccgtggacgacatc
acctttctccacccacatgggggcacctctcgaaaggtggcccaggggagtcgatcaagt
ctgggtgcccgcagcatgtcagacattcgcagcggccccagccaacacttggacagcccc
aacgttggtgtctatgagggagacagggtttggctgaagaaattcccaggggatcagcac
atagctatccgcccagcaaccaagacggccttctccaagctccaggagctccggcatgag
aacgtggccctctacctggggcttttcctggctcggggagcagaaggccctgcggccctc
tgggagggcaacctggctgtggtctcagagcactgcacgcggggctctcttcaggacctc
cttactcagagagaaataaagctggactggatgttcaagtcctccctcctgctggacctt
atcaagggaataaggtatctgcaccatcgaggcgtagctcatgggcggctgaagtcacgg
aactgcatagtggatggcagattcgtactcaagatcactgaccacggccacgggagactg
ctggaagcacagaaggtgctaccggagcctcccagagcggaggaccagctgtggacagcc
ccggagctgcttagggacccagccctggagcgccggggaacgctggccggcgacgtcttt
agcttggccatcatcatgcaagaagtagtgtgccgcagtgccccttatgccatgctggag
ctcactcccgaggaagtggtgcagagggtgcggagcccccctccactgtgtcggcccttg
gtgtccatggaccaggcacctgtcgagtgtatccacctgatgaagcagtgctgggcagag
cagccggaacttcggccctccatggaccacaccttcgacctgttcaagaacatcaacaag
ggccggaagacgaacatcattgactcgatgcttcggatgctggagcagtactctagtaac
ctggaggatctgatccgggagcgcacggaggagctggagctggaaaagcagaagacagac
cggctgcttacacagatgctgcctccgtctgtggctgaggccttgaagacggggacacca
gtggagcccgagtactttgagcaagtgacactgtactttagtgacattgtgggcttcacc
accatctctgccatgagtgagcccattgaggttgtggacctgctcaacgatctctacaca
ctctttgatgccatcattggttcccacgatgtctacaaggtggagacaataggggacgcc
tatatggtggcctcggggctgccccagcggaatgggcagcgacacgcggcagagatcgcc
aacatgtcactggacatcctcagtgccgtgggcactttccgcatgcgccatatgcctgag
gttcccgtgcgcatccgcataggcctgcactcaggtccatgcgtggcaggcgtggtgggc
ctcaccatgccgcggtactgcctgtttggggacacggtcaacaccgcctcgcgcatggag
tccaccgggctgccttaccgcatccacgtgaacttgagcactgtggggattctccgtgct
ctggactcgggctaccaggtggagctgcgaggccgcacggagctgaagggcaagggcgcc
gaggacactttctggctagtgggcagacgcggcttcaacaagcccatccccaaaccgcct
gacctgcaaccggggtccagcaaccacggcatcagcctgcaggagatcccacccgagcgg
cgacggaagctggagaaggcgcggccgggccagttctcttga

DBGET integrated database retrieval system