KEGG   Pan paniscus (bonobo): 100976686
Entry
100976686         CDS       T02283                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100976686 (ERAP1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100976686 (ERAP1)
Peptidases and inhibitors [BR:pps01002]
 Metallo peptidases
  Family M1
   100976686 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF1570
Other DBs
NCBI-GeneID: 100976686
NCBI-ProteinID: XP_003817982
Position
5
AA seq 948 aa
MVFLPLKWSLATMSFLLSSLLALLTVSTPSWCQSTEASPKRSDGTPFPWNKIRLPEYVIP
VHYDLLIHANLTTLTFWGTTKVEITASQPTSTIILHSHHLQISRATLRKGAGERLSEEPL
QVLEHPPQEQIALLAPEPLLVGLLYTVVIHYAGNLSETFHGFYKSTYRTKEGELRILAST
QFEPTAARMAFPCFDEPAFKASFSIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVTV
KMSTYLVAFIISDFESVSKITKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSIP
YPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMTVAHELAHQWF
GNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVGDYFFGKCFDAMEVDALNSSHPVS
TPVGNPAQIREMFDDVSYDKGACILNMLREYLSADAFKSGIVQYLQKHSYKNTKNEDLWD
SMASICPTDGVKGMDGFCSRSQHSSSSSHWHQEGLDVKTMMNTWTLQKGFPLITITVRGR
NVHMKQEHYMKGSDGAPDTGYLWHVPLTFITSKSDMVHRFLLKTKTDVLILPEEVEWIKF
NVGMNGYYIVHYEDDGWDSLTGLLKGTHTAVSSNDRASLINNAFQLVSIGKLSIEKALDL
SLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEG
SVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLSLPVDVTLAVFAVGAQSTE
GWDFLYSKYQFSLSSTEKSQIEFALCRTQNKEKLQWLLDESFKGDKIKTQEFPQILTLIG
RNAVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKE
NGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLEHDPEADATG
NT seq 2847 nt   +upstreamnt  +downstreamnt
atggtgtttctgcccctcaaatggtcccttgcaaccatgtcatttctactttcctcactg
ttggctctcttaactgtgtccactccttcatggtgtcagagcactgaagcatctccaaaa
cgtagtgatgggacaccatttccttggaataaaatacgacttcctgagtacgtcatccca
gttcattatgatctcttgatccatgcaaaccttaccacgctgaccttctggggaaccacg
aaagtagaaatcacagccagtcagcccaccagcaccatcatcctgcatagtcaccacctg
cagatatctagggccaccctcaggaagggagctggagagaggctatcagaagaacccctg
caggtcctggaacacccccctcaggagcaaattgcactgctggctcccgagcccctcctt
gtcgggctcctgtacacagttgtcattcactatgctggcaatctttcggagactttccac
ggattttacaaaagcacctacagaaccaaggaaggggaactgaggatactagcatcaaca
caatttgaacccactgcagctagaatggcctttccctgctttgatgaacctgccttcaaa
gcaagtttctcaatcaaaattagaagagagccaaggcacctagccatctccaatatgcca
ttggtgaaatctgtgactgttgctgaaggactcatagaagaccattttgatgtcactgtg
aagatgagcacctatctggtggccttcattatttcagattttgagtctgtcagcaagata
accaagagtggagtcaaggtttctgtttatgctgtgccagacaagataaatcaagcagat
tatgcactggatgctgcggtgactcttctagaattttatgaggattatttcagcataccg
tatcccctacccaaacaagatcttgctgctattcccgactttcagtctggtgctatggaa
aactggggactgacaacatatagagaatctgctctgttgtttgatgcagaaaagtcttct
gcatcaagtaagcttggcatcacaatgactgtggcccatgaactggcccaccagtggttt
gggaacctggtcactatggaatggtggaatgatctttggctaaatgaaggatttgccaaa
tttatggagtttgtgtctgtcagtgtgacccatcctgaactgaaagttggagattatttc
tttggcaaatgttttgacgcaatggaggtagatgctttaaattcctcacaccctgtgtct
acacctgtgggaaatcctgctcagatccgggagatgtttgatgatgtttcttatgataag
ggagcttgtattctgaatatgctaagggagtatcttagtgctgacgcatttaaaagtggt
attgtacagtatctccagaagcatagctataaaaatacaaaaaacgaggacctgtgggat
agtatggcaagtatttgccctacagatggtgtaaaagggatggatggcttttgctctaga
agtcaacattcatcttcatcctcacattggcatcaggaagggctggatgtgaaaaccatg
atgaacacttggacactgcagaagggttttcccctaataaccatcacagtgagggggagg
aatgtacacatgaagcaagagcactacatgaagggctctgacggcgccccggacactggg
tacctgtggcatgttccattgacattcatcaccagcaaatccgacatggtccatcgattt
ttgctaaaaacaaaaacagatgtgctcatcctcccagaagaggtggaatggatcaaattt
aatgtgggcatgaatggctattacattgtgcattacgaggatgatggatgggactctttg
actggccttttaaaaggaacacacacagcagtcagcagtaatgatcgggcgagtctcatt
aacaatgcatttcagctcgtcagcattgggaagctgtccattgaaaaggccttggattta
tccctgtacttgaaacatgaaactgaaattatgcccgtgtttcaaggtttgaatgagctg
attcctatgtataagttaatggagaaaagagatatgaatgaagtggaaactcaattcaag
gccttcctcatcaggctgctaagggacctcattgataagcagacatggacagatgagggc
tcagtctcagagcgaatgctgcggagtcaactactactcctcgcctgtgtgcacaactat
cagccgtgcgtacagagggcagaaggctatttcagaaagtggaaggaatccaatggaaac
ttgagcctgcctgtcgacgtgaccttggcagtgtttgctgtgggggcccagagcacagaa
ggctgggattttctttatagtaaatatcagttttctttgtccagtactgagaaaagccaa
attgaatttgccctctgcagaacccaaaataaggagaagcttcaatggctactagatgaa
agctttaagggagataaaataaaaactcaggagtttccacaaattcttacactcattggc
aggaacgcagtaggatacccattggcctggcaatttctgaggaaaaactggaacaaactt
gtacaaaagtttgaacttggctcatcttccatagcccacatggtaatgggtacaacaaat
caattctccacaagaacacggcttgaagaggtaaaaggattcttcagctctttgaaagaa
aatggttctcagctccgttgtgtccaacagacaattgaaaccattgaagaaaacatcggt
tggatggataagaattttgataaaatcagagtgtggctgcaaagtgaaaagcttgaacat
gatcctgaagctgacgcaacaggatga

DBGET integrated database retrieval system