KEGG   Pan paniscus (bonobo): 100977055
Entry
100977055         CDS       T02283                                 

Definition
(RefSeq) patr class I histocompatibility antigen, alpha chain E
  KO
K06751  MHC class I antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04144  Endocytosis
pps04145  Phagosome
pps04218  Cellular senescence
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04940  Type I diabetes mellitus
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05203  Viral carcinogenesis
pps05320  Autoimmune thyroid disease
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100977055
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100977055
   04145 Phagosome
    100977055
  09143 Cell growth and death
   04218 Cellular senescence
    100977055
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100977055
   04612 Antigen processing and presentation
    100977055
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100977055
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100977055
   05170 Human immunodeficiency virus 1 infection
    100977055
   05168 Herpes simplex virus 1 infection
    100977055
   05163 Human cytomegalovirus infection
    100977055
   05167 Kaposi sarcoma-associated herpesvirus infection
    100977055
   05169 Epstein-Barr virus infection
    100977055
   05165 Human papillomavirus infection
    100977055
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100977055
   05330 Allograft rejection
    100977055
   05332 Graft-versus-host disease
    100977055
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100977055
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100977055
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100977055
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pps00537]
    100977055
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100977055
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pps00537]
 Antigens
  100977055
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3 Ig_3 C2-set_2 ig MHC_I_C
Other DBs
NCBI-GeneID: 100977055
NCBI-ProteinID: XP_008957737
Position
6
AA seq 350 aa
MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDND
AASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMH
GCDLGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISERKSNDACEAEHQRAY
LEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQ
DGEGHTQDTELVDTRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWKPASQ
PTIPIVGIIAGLVLLGSVVSGAVVAAVMWRKKSSGGKGRSYSKAEWSDSA
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggtagatggaaccctccttctactcctctcggaggccctggcccttacccagacctgg
gcgggctcccactccttgaagtatttccacacttccgtgtcccggcccggccgcggggag
ccccgcttcatctctgtgggctacgtggacgacacccagttcgtgcgcttcgacaacgac
gccgcgagtccgaggatggtgccgcgggcgccgtggatggagcaggaggggtcagagtat
tgggaccgggagacacggagcgccagggacaccgcacagattttccgagtgaacctgcgg
accctgcgcgggtactacaatcagagcgaggccgggtctcacaccctgcagtggatgcat
ggctgcgacctggggcccgacgggcgcttcctccgcgggtatgaacagttcgcctacgac
ggcaaggattatctcaccctgaatgaggacctgcgctcctggaccgcggtggacacggcg
gctcagatctccgagcgaaagtcaaatgatgcctgtgaggcggagcaccagagagcctac
ctggaagacacatgcgtggagtggctccacaaatacctggagaaggggaaggagacgctg
cttcacctggagcccccaaagacacacgtgacccaccaccccatctctgaccatgaggcc
accctgaggtgctgggccctgggcttctaccctgcggagatcacactgacctggcagcag
gatggagagggccatacccaggacacggagcttgtggacaccaggcctgcaggggatgga
accttccagaagtgggcagctgtggtggtgccttctggagaggagcagagatacacgtgc
catgtgcagcatgaggggctacccgagcccctcaccctgagatggaagccggcttcccag
cccaccatccccatcgtgggcatcattgctggcctggttctccttggatctgtggtctct
ggagctgtggttgctgctgtgatgtggaggaagaagagctcaggtggaaaaggacggagc
tactctaaggctgagtggagcgacagtgcctag

KEGG   Pan paniscus (bonobo): 100978112
Entry
100978112         CDS       T02283                                 

Gene name
Papa-A
Definition
(RefSeq) patr class I histocompatibility antigen, A-2 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04144  Endocytosis
pps04145  Phagosome
pps04218  Cellular senescence
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04940  Type I diabetes mellitus
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05203  Viral carcinogenesis
pps05320  Autoimmune thyroid disease
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100978112 (Papa-A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100978112 (Papa-A)
   04145 Phagosome
    100978112 (Papa-A)
  09143 Cell growth and death
   04218 Cellular senescence
    100978112 (Papa-A)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100978112 (Papa-A)
   04612 Antigen processing and presentation
    100978112 (Papa-A)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100978112 (Papa-A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100978112 (Papa-A)
   05170 Human immunodeficiency virus 1 infection
    100978112 (Papa-A)
   05168 Herpes simplex virus 1 infection
    100978112 (Papa-A)
   05163 Human cytomegalovirus infection
    100978112 (Papa-A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100978112 (Papa-A)
   05169 Epstein-Barr virus infection
    100978112 (Papa-A)
   05165 Human papillomavirus infection
    100978112 (Papa-A)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100978112 (Papa-A)
   05330 Allograft rejection
    100978112 (Papa-A)
   05332 Graft-versus-host disease
    100978112 (Papa-A)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100978112 (Papa-A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100978112 (Papa-A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100978112 (Papa-A)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pps00537]
    100978112 (Papa-A)
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100978112 (Papa-A)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pps00537]
 Antigens
  100978112 (Papa-A)
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 100978112
NCBI-ProteinID: NP_001266160
UniProt: Q30900
Position
6
AA seq 365 aa
MAVLPPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRF
DSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAHSQTDRVNLGTLRGYYNQSEDGSHTIQ
IMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQR
RAYLEGLCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
SSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSL
TACKV
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggccgtcctgccgccccgaactctcctcctgctactctcgggggccctggccctgacc
cagacctgggcgggctcccactccatgaggtatttcttcacctccgtgtcccggcccggc
cgcggggagccccgcttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgcgagccagaggatggagccgcgggcgccgtggatagagcaggagggt
ccggagtattgggaccaggagacacggaatgtgaaggcccactcacagactgaccgagtg
aacctggggaccctgcgcggctactacaaccagagcgaggacggttctcacaccatccag
ataatgtatggctgcgacgtggggtcggacgggcgcttcctccgcgggtaccggcaggac
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcttggaccgcggcg
gacatggcagctcagatcaccaagcgcaagtgggaggcggcccatgcggcggagcagcgg
agagcctacctggagggcctgtgcgtggacgggctccgcagatacctggagaacgggaag
gagacgctgcagcgcacggacccccccaagacacatatgacccaccaccccatctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggaccagacccaggacacggagctcgtggagaccaggcccgca
ggggatggaaccttccagaagtgggcggctgtggtggtaccttctggagaggagcagaga
tacacctgccatgtgcagcatgagggtcttcccaagcccctcaccctgagatgggagccg
tcttcccagcccaccatccccattgtgggcatcattgctggcctggttctccttggagct
gtgatcactggagctgtggtcgctgccgtgatgtggaggaggaagagctcagatagaaaa
ggagggagctacactcaggctgcaagcagtgacagtgcccagggctctgatgtgtctctc
acagcttgtaaagtgtga

KEGG   Pan paniscus (bonobo): 100978457
Entry
100978457         CDS       T02283                                 

Gene name
MHC-F, PAPAF1
Definition
(RefSeq) patr class I histocompatibility antigen, CH28 alpha chain
  KO
K06751  MHC class I antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04144  Endocytosis
pps04145  Phagosome
pps04218  Cellular senescence
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04940  Type I diabetes mellitus
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05203  Viral carcinogenesis
pps05320  Autoimmune thyroid disease
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100978457 (MHC-F)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100978457 (MHC-F)
   04145 Phagosome
    100978457 (MHC-F)
  09143 Cell growth and death
   04218 Cellular senescence
    100978457 (MHC-F)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100978457 (MHC-F)
   04612 Antigen processing and presentation
    100978457 (MHC-F)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100978457 (MHC-F)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100978457 (MHC-F)
   05170 Human immunodeficiency virus 1 infection
    100978457 (MHC-F)
   05168 Herpes simplex virus 1 infection
    100978457 (MHC-F)
   05163 Human cytomegalovirus infection
    100978457 (MHC-F)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100978457 (MHC-F)
   05169 Epstein-Barr virus infection
    100978457 (MHC-F)
   05165 Human papillomavirus infection
    100978457 (MHC-F)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100978457 (MHC-F)
   05330 Allograft rejection
    100978457 (MHC-F)
   05332 Graft-versus-host disease
    100978457 (MHC-F)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100978457 (MHC-F)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100978457 (MHC-F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100978457 (MHC-F)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pps00537]
    100978457 (MHC-F)
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100978457 (MHC-F)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pps00537]
 Antigens
  100978457 (MHC-F)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 100978457
NCBI-ProteinID: XP_008953334
Position
6
AA seq 389 aa
MAPRSLLLLLSGALALTETWAGECGVQRETASVGRSEGPPGGGAGLREPRPEEGRAGLSP
SSPPGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEG
PQYWERTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQH
AYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGK
ETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPA
GDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPQPLTLRWEQSPQPTIPIVGIVAGLVVLGA
VVTGAVVAAVMWRKNSSDRNRGSYSQAAV
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggcgccccgaagcctcctcctgctgctctcaggggccctggccctgaccgagacttgg
gcaggtgagtgcggggtccagagagaaacggcctctgtggggaggagtgaggggccgccc
ggtgggggcgcaggactcagggagccgcgcccggaagagggtcgggcgggtctcagcccc
tcctcgcccccaggctcccactccttgaggtatttcagcaccgctgtgtcgcggcccggc
cgcggggagccccggtacatcgccgtggagtacgtagacgacacgcagttcctgcggttc
gacagcgacgccgcgattccgaggatggagcctcgggagccgtgggtggagcaagagggg
ccgcagtattgggagaggaccacaggatacgcgaaggccaacgcacagactgaccgagtg
gccctgaggaacctgctccgccgctacaaccagagcgaggccgggtctcacaccctccag
ggaatgaatggctgcgacatggggcccgacggacgcctcctccgcgggtatcaccagcac
gcgtacgacggcaaggattacatctccctgaacgaggacctgcgctcctggaccgcggcg
gacaccgtggctcagatcacccagcgcttctatgaggcagaggaatatgcagaggagttc
aggacctacctggagggcgagtgcctggagttgctccgcagatacttggagaacgggaag
gagacgctacagcgcgcagatcctccaaaggcacacgttgcccaccaccccatctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacgctgacc
tggcagcgggacggggaggaacagacccaggacacagagcttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggccgctgtggtggtgccttctggagaggaacagaga
tacacgtgccatgtgcagcacgaggggctgccccagcccctcaccctgagatgggagcag
tctccccagcccaccatccccatcgtgggcatcgttgctggccttgttgtccttggagct
gtggtcactggagctgtggtcgctgctgtgatgtggaggaagaacagctcagatagaaac
agagggagctactctcaggctgcagtgtga

KEGG   Pan paniscus (bonobo): 100978774
Entry
100978774         CDS       T02283                                 

Gene name
MHC-G
Definition
(RefSeq) patr class I histocompatibility antigen, alpha chain G
  KO
K06751  MHC class I antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04144  Endocytosis
pps04145  Phagosome
pps04218  Cellular senescence
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04940  Type I diabetes mellitus
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05203  Viral carcinogenesis
pps05320  Autoimmune thyroid disease
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100978774 (MHC-G)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100978774 (MHC-G)
   04145 Phagosome
    100978774 (MHC-G)
  09143 Cell growth and death
   04218 Cellular senescence
    100978774 (MHC-G)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100978774 (MHC-G)
   04612 Antigen processing and presentation
    100978774 (MHC-G)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100978774 (MHC-G)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100978774 (MHC-G)
   05170 Human immunodeficiency virus 1 infection
    100978774 (MHC-G)
   05168 Herpes simplex virus 1 infection
    100978774 (MHC-G)
   05163 Human cytomegalovirus infection
    100978774 (MHC-G)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100978774 (MHC-G)
   05169 Epstein-Barr virus infection
    100978774 (MHC-G)
   05165 Human papillomavirus infection
    100978774 (MHC-G)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100978774 (MHC-G)
   05330 Allograft rejection
    100978774 (MHC-G)
   05332 Graft-versus-host disease
    100978774 (MHC-G)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100978774 (MHC-G)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100978774 (MHC-G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100978774 (MHC-G)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pps00537]
    100978774 (MHC-G)
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100978774 (MHC-G)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pps00537]
 Antigens
  100978774 (MHC-G)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3 C2-set_2 ig SNO
Other DBs
NCBI-GeneID: 100978774
NCBI-ProteinID: XP_008953345
UniProt: A0A2R9AFZ9
Position
6
AA seq 338 aa
MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVWF
DSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRINLQTLRGYYNQSEASSHTLQ
WMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANAAEQR
RAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILT
WQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQ
SSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggtggtcatggcgccccgaaccctcttcctgctgctctcgggggccctgaccctgacc
gagacctgggcgggctcccactccatgaggtatttcagcgccgccgtgtcccggcccggc
cgcggggagccccgcttcatcgccatgggctacgtggacgacacgcagttcgtgtggttc
gacagcgactcggcgtgtccgaggatggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaagaggagacacggaacaccaaggcccacgcacagactgacagaata
aacctgcagaccctgcgcggctactacaaccagagcgaggccagttctcacaccctccag
tggatgattggctgcgacctggggtccgacggacgcctcctccgcgggtatgaacagtat
gcctacgatggcaaggattacctcgccctgaacgaggacctgcgctcctggaccgcagcg
gacactgcggctcagatctccaagcgcaagtgtgaggcggccaatgcggctgaacaaagg
agagcctacctggagggcacgtgcgtggagtggctccacagatacctggagaacgggaag
gagatgctgcagcgcgcggacccccccaagacacacgtgacccaccaccctgtctttgac
tatgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcatactgacc
tggcagcgggatggggaggaccagacccaggacgtggagctcgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcagctgtggtggtgccttctggagaggagcagaga
tacacgtgccatgtgcagcatgaggggctgccggagcccctcatgctgagatggaagcag
tcttccctgcccaccatccccatcatgggtatcgttgctggcctggttgtccttgcagct
gtagtcactggagctgcggtcgctgctgtgctgtggaggaagaagagctcagattga

KEGG   Pan paniscus (bonobo): 100979338
Entry
100979338         CDS       T02283                                 

Gene name
HLA-H
Definition
(RefSeq) putative HLA class I histocompatibility antigen, alpha chain H
  KO
K06751  MHC class I antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04144  Endocytosis
pps04145  Phagosome
pps04218  Cellular senescence
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04940  Type I diabetes mellitus
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05203  Viral carcinogenesis
pps05320  Autoimmune thyroid disease
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100979338 (HLA-H)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100979338 (HLA-H)
   04145 Phagosome
    100979338 (HLA-H)
  09143 Cell growth and death
   04218 Cellular senescence
    100979338 (HLA-H)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100979338 (HLA-H)
   04612 Antigen processing and presentation
    100979338 (HLA-H)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100979338 (HLA-H)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100979338 (HLA-H)
   05170 Human immunodeficiency virus 1 infection
    100979338 (HLA-H)
   05168 Herpes simplex virus 1 infection
    100979338 (HLA-H)
   05163 Human cytomegalovirus infection
    100979338 (HLA-H)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100979338 (HLA-H)
   05169 Epstein-Barr virus infection
    100979338 (HLA-H)
   05165 Human papillomavirus infection
    100979338 (HLA-H)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100979338 (HLA-H)
   05330 Allograft rejection
    100979338 (HLA-H)
   05332 Graft-versus-host disease
    100979338 (HLA-H)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100979338 (HLA-H)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100979338 (HLA-H)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100979338 (HLA-H)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pps00537]
    100979338 (HLA-H)
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100979338 (HLA-H)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pps00537]
 Antigens
  100979338 (HLA-H)
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 100979338
NCBI-ProteinID: XP_008953344
UniProt: A0A2R9AXD2
Position
6
AA seq 403 aa
MPRLGDSPPPQFLLFSPPETGPSSSILTKRTQFSFPLGVGFLEKPIGAAAVPVLKSPRTH
RDSDSPQTPRMVLMAPRTLLLLLSGTLALTQTWARSHSMRYFYTTMSRPGRGEPRFISVG
YVDDTQFVRFDSDDASPREEPRAPWMEREGPEYWDRNTQICKAQAQTERENLRMALRYYN
QSEGCSHTMQVMYGCDVGPDGRFLRGYEQHAYDGKDYIALNEDLSSWTAADMAAQITKRK
WEAARRPEQLRAYLEGEFVEWLRRYLENGKETLQRAEITLTWQRDGEDQTQDTELVETRP
AGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTVPIVGIVAGLVLLV
AVVTGAVVAAVMWRKKSSDRKGGSYSQAASSNSAQGSDVSLTA
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgccccgccttggggattcgccacctccgcagtttctcttattctcaccacctgagacg
ggtccttcttcctccatactcacgaagcggacacagttctcattcccactaggtgtcggg
tttctagagaagccaatcggtgccgccgcggtcccggttctaaagtccccacgcacccac
cgggactcagattctccccagacgccgaggatggtgctcatggcgccccgaaccctcctc
ctgctgctctcagggaccctggccctgacccagacttgggcgcgctcccactccatgagg
tatttctacaccaccatgtcccggcccggccgcggggagccccgcttcatctccgtcggc
tacgtggacgatacgcagttcgtgcggtttgacagcgacgacgcgagtccgagagaggag
ccgcgggcgccgtggatggagcgggaggggccggagtattgggaccggaacacacagatc
tgcaaggcccaggcacagactgaacgagagaacctgcggatggcgctccgctactacaac
cagagcgagggctgttctcacaccatgcaggtgatgtatggctgcgacgtggggcccgac
gggcgcttcctccgcgggtatgaacagcacgcctacgacggcaaggattacatcgctctg
aacgaggacctgagctcctggaccgcggcggacatggcagctcagatcaccaagcgcaag
tgggaggcggcccgtcggccggagcagttgagagcctacctggagggcgagttcgtggag
tggctccgcagatacctggagaacgggaaggagacgctgcagcgcgcggagatcacactg
acctggcagcgggatggggaggaccagacccaggacacggagctcgtggagaccaggcct
gcaggggatggaaccttccagaagtgggcggctgtggtggtgccttctggagaggagcag
agatacacctgccatgtgcagcatgagggtctgcccgagcccctcactctgagatgggag
ccatcttcccagcccaccgtccccatcgtgggcatcgttgctggcctggttctacttgta
gctgtggtcactggagctgtggtcgctgctgtaatgtggaggaagaagagctcagataga
aaaggagggagctactctcaggctgcaagcagcaacagtgcccagggctctgatgtgtct
ctcacggcttga

KEGG   Pan paniscus (bonobo): 100982294
Entry
100982294         CDS       T02283                                 

Gene name
Papa-C
Definition
(RefSeq) class I histocompatibility antigen, Gogo-C*0202 alpha chain
  KO
K06751  MHC class I antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04144  Endocytosis
pps04145  Phagosome
pps04218  Cellular senescence
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04940  Type I diabetes mellitus
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05203  Viral carcinogenesis
pps05320  Autoimmune thyroid disease
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100982294 (Papa-C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100982294 (Papa-C)
   04145 Phagosome
    100982294 (Papa-C)
  09143 Cell growth and death
   04218 Cellular senescence
    100982294 (Papa-C)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100982294 (Papa-C)
   04612 Antigen processing and presentation
    100982294 (Papa-C)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100982294 (Papa-C)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100982294 (Papa-C)
   05170 Human immunodeficiency virus 1 infection
    100982294 (Papa-C)
   05168 Herpes simplex virus 1 infection
    100982294 (Papa-C)
   05163 Human cytomegalovirus infection
    100982294 (Papa-C)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100982294 (Papa-C)
   05169 Epstein-Barr virus infection
    100982294 (Papa-C)
   05165 Human papillomavirus infection
    100982294 (Papa-C)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100982294 (Papa-C)
   05330 Allograft rejection
    100982294 (Papa-C)
   05332 Graft-versus-host disease
    100982294 (Papa-C)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100982294 (Papa-C)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100982294 (Papa-C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100982294 (Papa-C)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pps00537]
    100982294 (Papa-C)
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100982294 (Papa-C)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pps00537]
 Antigens
  100982294 (Papa-C)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig DUF1822 FeoB_associated
Other DBs
NCBI-GeneID: 100982294
NCBI-ProteinID: XP_003831652
UniProt: A0A023T6C6
Position
6
AA seq 366 aa
MRVMAPRTLLLLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRF
DSDAASPRGEPRAPWVEQEEPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQ
KMYGCDLGPDGRLLRGYEQFAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARAAEQW
RAYLEGLCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLPEPLTLRWEP
SSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDES
LITCKA
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgcgggtcatggcgccccgaaccctcctcctgctgctctcgggagccctggccctgacc
gagacctgggccggctcccactccatgaggtatttctacaccgccgtgtcccggcccggc
cgcggagagccccgcttcatcgcagtgggctacgtggatgacacgcagttcgtgcggttc
gacagcgacgccgcgagtccgagaggggagccgcgggcgccgtgggtggagcaggaggag
ccggagtattgggaccgggagacacagaagtacaagcgccaggcacaggctgaccgagtg
aacctgcggaaactgcgcggctactacaaccagagcgaggacgggtctcacactctccag
aagatgtatggctgcgacctggggcccgacgggcgcctcctccgcgggtatgagcagttc
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcctggaccgccgcg
gacacggcggctcagatctcccagcgcaagttggaggcggcccgtgcggcggagcagtgg
agagcctacctggagggcctgtgcgtggagtggctccgcagatacctggagaacgggaag
gagacgctgcagcgcgcagaacccccaaagacacacgtgacccaccaccccctctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggaccagacccaggacaccgagcttgtggagaccaggccagca
ggagatggaaccttccagaagtgggcagctgtggtggtgccttctggacaagagcagaga
tacacgtgccatatgcagcacgaggggctgccagagcccctcaccctgagatgggagcca
tcttcccagcccaccatccccatcatgggcatcgttgctggcctggctgtcctggttgtc
ctagctgtccttggagctgtggtcactgctatgatgtgtaggaggaagagctcaggtgga
aaaggagggagctgctctcaggctgcgtgcagcaacagtgcccagggctctgatgagtct
ctcatcacttgtaaagcctga

KEGG   Pan paniscus (bonobo): 100982859
Entry
100982859         CDS       T02283                                 

Gene name
PAPA-B
Definition
(RefSeq) class I histocompatibility antigen, Gogo-B*0101 alpha chain
  KO
K06751  MHC class I antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04144  Endocytosis
pps04145  Phagosome
pps04218  Cellular senescence
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04940  Type I diabetes mellitus
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05203  Viral carcinogenesis
pps05320  Autoimmune thyroid disease
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100982859 (PAPA-B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100982859 (PAPA-B)
   04145 Phagosome
    100982859 (PAPA-B)
  09143 Cell growth and death
   04218 Cellular senescence
    100982859 (PAPA-B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100982859 (PAPA-B)
   04612 Antigen processing and presentation
    100982859 (PAPA-B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100982859 (PAPA-B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100982859 (PAPA-B)
   05170 Human immunodeficiency virus 1 infection
    100982859 (PAPA-B)
   05168 Herpes simplex virus 1 infection
    100982859 (PAPA-B)
   05163 Human cytomegalovirus infection
    100982859 (PAPA-B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100982859 (PAPA-B)
   05169 Epstein-Barr virus infection
    100982859 (PAPA-B)
   05165 Human papillomavirus infection
    100982859 (PAPA-B)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100982859 (PAPA-B)
   05330 Allograft rejection
    100982859 (PAPA-B)
   05332 Graft-versus-host disease
    100982859 (PAPA-B)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100982859 (PAPA-B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100982859 (PAPA-B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100982859 (PAPA-B)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pps00537]
    100982859 (PAPA-B)
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100982859 (PAPA-B)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pps00537]
 Antigens
  100982859 (PAPA-B)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig MHC_I_3
Other DBs
NCBI-GeneID: 100982859
NCBI-ProteinID: XP_003831654
Position
6
AA seq 406 aa
MQVTAPRTVLLLLSAALALTETWAGSHSMRYFDTAVSRPGRGEPRFITVGYVDDTQFVRF
DSDAASPREEPRAPWMEQEGPEYWDRNTQICKAQAQTDRENLRIALRYYNQSEAGSHTLQ
RMYGCDVGPDGRLLRGYSQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQL
RAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGQEQRYTCHVQHEGLPEPLTLRWEP
SSQSTIPIVGIVAGLAVLAVVVTGAVVAAVMCRRKSSGGKGGSYSQAASSDSAQGSDVSH
SLKSLRQLSCEGLRCRISSRLXLCDFKSLWHLFLQRHLNVSASLLA
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgcaggtcacggcgccccgaaccgtcctcctgctgctctcggcggccctggccctgacc
gagacctgggccggctcccactccatgaggtatttcgacaccgccgtgtcccggcccggc
cgcggggagccccgcttcatcaccgtgggctacgtggacgacacgcagttcgtgaggttc
gacagcgacgccgcgagtccgagagaggagccgcgggcgccgtggatggagcaggagggg
cctgagtattgggaccggaacacacagatctgcaaggcccaggcacagactgaccgagag
aacctgcggatcgcgctccgctactacaaccagagcgaggccgggtctcacaccctccag
aggatgtatggctgcgacgtggggccggacgggcgcctcctccgcgggtatagccagtcc
gcctacgacggcaaggattacatcgccctgaacgaggacctgagctcctggaccgcggcg
gacacggcggctcagatcacccagcgcaagtgggaggcggcccgtgtggcggagcagctg
agagcctacctggagggcctgtgcgtggagtggctccgcagatacctggagaacgggaag
gagacgctgcagcgcgcggaccccccaaagacacacgtgacccaccaccccatctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggaccaaactcaggacactgagcttgtggagaccaggccagca
ggagatagaaccttccagaagtgggcagctgtggtggtgccttctggacaagagcagaga
tacacatgccatgtgcagcatgaggggctgccggagcccctcaccctgagatgggagcca
tcttcccagtccaccatccccatcgtgggcattgttgctggcctggctgtcctagcagtt
gtggtcaccggagctgtggtcgctgctgtgatgtgtaggaggaagagctcaggtggaaaa
ggagggagctactcccaggctgcgtccagcgacagtgcccagggctctgatgtctctcac
agcttgaaaagcctgagacagctgtcttgtgagggactgagatgcaggatttcttcacgc
ctcnccctttgtgacttcaagagcctctggcatctctttctgcaaaggcacctgaatgtg
tctgcgtccctgttagcataa

KEGG   Pan paniscus (bonobo): 100993452
Entry
100993452         CDS       T02283                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-3 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04144  Endocytosis
pps04145  Phagosome
pps04218  Cellular senescence
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04940  Type I diabetes mellitus
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05203  Viral carcinogenesis
pps05320  Autoimmune thyroid disease
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100993452
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100993452
   04145 Phagosome
    100993452
  09143 Cell growth and death
   04218 Cellular senescence
    100993452
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100993452
   04612 Antigen processing and presentation
    100993452
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100993452
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100993452
   05170 Human immunodeficiency virus 1 infection
    100993452
   05168 Herpes simplex virus 1 infection
    100993452
   05163 Human cytomegalovirus infection
    100993452
   05167 Kaposi sarcoma-associated herpesvirus infection
    100993452
   05169 Epstein-Barr virus infection
    100993452
   05165 Human papillomavirus infection
    100993452
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100993452
   05330 Allograft rejection
    100993452
   05332 Graft-versus-host disease
    100993452
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100993452
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100993452
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100993452
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pps00537]
    100993452
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100993452
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pps00537]
 Antigens
  100993452
SSDB
Motif
Pfam: MHC_I C1-set
Other DBs
NCBI-GeneID: 100993452
NCBI-ProteinID: XP_008953338
Position
6
AA seq 360 aa
MKSPKDGVMAPRTLLLLLSGALVLTQTWAGFHSLRYFHTTMSRPGHADPRFLSVGDVDDT
QCVRLDSDATSPRMEPRAPWMEQEGPEYWEEETGTAKAKAQFYRVNLRTLSGYYNQSEAW
SHTIXRMSVCDVGSDGRLLRGYHQLAYDGKDYIVLNEDLCSLTAADTAAQITQLKWEAAR
GVELLKTYLPGRWAEWLSKGLKNEKERLQCADPLKAQVTHHPISNHEAVLRCWALGFYPL
EITLTQEWDGEDQIQDAEFVGTRLARYRTFQKWAAAVVSSGEKQRYTCHVQHEGLPEPLT
LRWELSSQPIIPVVGIIAGLVLLVAVFTVAVVAAVMWRNKIPAPVKMKDKFITLIVVMGT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaaatcgccaaaagatggtgtcatggcgccccgaaccctgcttctgctgctctcgggg
gccctggtcctgacccagacctgggcaggcttccactccttgaggtatttccacaccacc
atgtcccggcccggccacgcggatccccgcttcctctccgtgggcgacgtggacgacacg
cagtgcgtgcggctcgacagcgacgccacgagtcccaggatggagccgcgggcgccgtgg
atggagcaggaggggccggaatattgggaagaggagacagggaccgccaaggccaaagca
cagttttaccgagtgaacctgcggaccctgagcggctactacaaccagagtgaggcctgg
tctcacaccatctagaggatgtctgtctgcgacgtggggtcggacgggcgcctactccgc
gggtatcaccagctcgcttacgatggcaaggattacatcgtcctgaacgaggacctgtgc
tccttgacagccgcagacacggcggctcagatcacccagcttaagtgggaggcggcccgg
ggggtggagctgctcaaaacctacctgcccggaaggtgggcggagtggctcagcaaaggc
cttaagaatgagaaggagaggctgcaatgcgcagatcccctgaaggcacaggtaacccac
caccccatctccaaccatgaggccgtgctgaggtgctgggccctgggcttctaccctctg
gagatcacactgacccaggagtgggatggggaggaccaaattcaggatgcagagtttgtg
gggaccagacttgcacggtacagaaccttccagaagtgggcagctgcagtggtgtcttct
ggagagaagcagaggtacacatgccatgtgcagcacgaggggttgcctgagcccctcaca
ctaagatgggagctgtcttcccagcccatcatccccgttgtgggcatcattgctggcctg
gttcttctagttgctgtattcactgtagctgtggtcgctgctgtgatgtggaggaataag
atcccagcacctgtgaaaatgaaggacaaatttatcaccttgattgtagtcatgggaacc
tga

DBGET integrated database retrieval system