KEGG   Pan paniscus (bonobo): 100977114
Entry
100977114         CDS       T02283                                 

Gene name
IRF3
Definition
(RefSeq) interferon regulatory factor 3
  KO
K05411  interferon regulatory factor 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps05133  Pertussis
pps05135  Yersinia infection
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05203  Viral carcinogenesis
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100977114 (IRF3)
   04621 NOD-like receptor signaling pathway
    100977114 (IRF3)
   04622 RIG-I-like receptor signaling pathway
    100977114 (IRF3)
   04623 Cytosolic DNA-sensing pathway
    100977114 (IRF3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100977114 (IRF3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100977114 (IRF3)
   05161 Hepatitis B
    100977114 (IRF3)
   05160 Hepatitis C
    100977114 (IRF3)
   05171 Coronavirus disease - COVID-19
    100977114 (IRF3)
   05164 Influenza A
    100977114 (IRF3)
   05162 Measles
    100977114 (IRF3)
   05168 Herpes simplex virus 1 infection
    100977114 (IRF3)
   05163 Human cytomegalovirus infection
    100977114 (IRF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100977114 (IRF3)
   05169 Epstein-Barr virus infection
    100977114 (IRF3)
   05165 Human papillomavirus infection
    100977114 (IRF3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100977114 (IRF3)
   05133 Pertussis
    100977114 (IRF3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100977114 (IRF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100977114 (IRF3)
   04131 Membrane trafficking [BR:pps04131]
    100977114 (IRF3)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    100977114 (IRF3)
Membrane trafficking [BR:pps04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    100977114 (IRF3)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 100977114
NCBI-ProteinID: XP_003814385
UniProt: A0A2R9B6Q3
Position
19
AA seq 427 aa
MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEA
TGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQP
DTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPT
PFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPG
WPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELL
PNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTK
RLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMD
FQGPGET
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgggaaccccaaagccacggatcctgccctggctggtgtcgcagctggacctggggcaa
ctggagggcgtggcctgggtgaacaagagccgcacgcgcttccgcatcccttggaagcac
ggcctacggcaggatgcacagcaggaggatttcggaatcttccaggcctgggccgaggcc
actggcgcatatgttcccgggagggataagccagacctgccaacctggaagaggaatttc
cgctctgccctcaaccgcaaagaagggctgcgcttagcagaggaccggagcaaggaccct
cacgacccacataaaatctacgagtttgtgaactcaggagttggggacttttcccagcca
gacacctctccggacaccaatggtggaggcagtacttctgatacccaggaagacattctg
gatgagttactgggtaacatggtgttggccccactcccagatccgggacccccaagcctg
gctgtagcccctgagccctgccctcagcccctgcggagccccagcttggacaatcccact
cccttcccaaacctggggccctctgagaacccactgaagcggctgttggtaccgggggaa
gagtgggagttcgaggtgacagccttctaccggggccgccaagtcttccagcagaccatc
tcctgcccagagggcctgcggctggtggggtccgaagtgggagacaggacgctgcctgga
tggccagtcacactgccagaccctggcatgtccctgacagacaggggagtgatgagctac
gtgaggcatgtgctgagctgcctgggtgggggactggctctctggcgggccgggcagtgg
ctctgggcccagcggctggggcactgccacacatactgggcagtgagcgaggagctgctc
cccaacagcgggcatgggcctgatggcgaggtccccaaggacaaggaaggaggcgtgttt
gacctggggcccttcattgtagatctgattaccttcacggaaggaagcggacgctcacca
cgctatgccctctggttctgtgtgggggaatcatggccccaggaccagccgtggaccaag
aggctcgtgatggtcaaggttgtgcccacgtgcctcagggccttggtagaaatggcccgg
gtagggggtgcctcctccctggagaacactgtggacctgcacatttccaacagccaccca
ctctccctcacctccgaccagtacaaggcctacctgcaggacttggtggagggcatggat
ttccagggccctggggagacctga

DBGET integrated database retrieval system