KEGG   Pan paniscus (bonobo): 100977210
Entry
100977210         CDS       T02283                                 

Definition
(RefSeq) galectin-9
  KO
K10093  galectin-9
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:pps04091]
    100977210
Lectins [BR:pps04091]
 S-type lectins (Galectins)
  100977210
SSDB
Motif
Pfam: Gal-bind_lectin Peptidase_C62
Other DBs
NCBI-GeneID: 100977210
NCBI-ProteinID: XP_003812702
UniProt: A0A2R9C379
Position
17
AA seq 323 aa
MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAF
HFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFV
QYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPA
IPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGSHIAFHLNPRF
DENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHR
LRNLPTINRLEVGGDIQLTHVQT
NT seq 972 nt   +upstreamnt  +downstreamnt
atggccttcagcggttcccaggctccctacctgagtccagccgtccccttttctgggact
attcaaggaggtctccaggacggacttcagatcactgtcaatgggaccgttctcagctcc
agtggaaccaggtttgctgtgaactttcagactggcttcagtggaaatgacattgccttc
cacttcaaccctcggtttgaagacggagggtacgtggtgtgcaacacgaggcagaacgga
agctgggggcctgaggagaggaagacgcacatgcctttccagaaggggatgccctttgac
ctctgcttcctggtgcagagctcagatttcaaggtgatggtgaacgggagcctcttcgtg
cagtacttccaccgtgtgcccttccaccgggtggacaccatctccgtcaatggctctgtg
cagctgtcctacatcagcttccagcctcccggcgtgtggcctgccaacccggctcccatt
acccagacagtcatccacacagtgcagagcgcccctggacagatgttctctactcccgcc
atcccacctatgatgtacccccaccccgcctatccgatgcctttcatcaccaccattctg
ggagggctgtacccatccaagtccatcctgctgtcaggcactgtcctgcccagtgctcag
aggttccacatcaacctgtgctctgggagccacatcgccttccacctgaacccccgtttt
gatgagaatgctgtggtccgcaacacccagatcgacaactcctgggggtctgaggagcga
agtctgccccgaaaaatgcccttcgtccgtggccagagcttctcggtgtggatcttgtgt
gaagctcactgcctcaaggtggccgtggatggtcagcacctgtttgaatactaccatcgc
ctgaggaacctgcccaccatcaacagactggaagtggggggcgacatccagctgacccac
gtgcagacatag

DBGET integrated database retrieval system