KEGG   Pan paniscus (bonobo): 100977378Help
Entry
100977378         CDS       T02283                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B11-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00040  Pentose and glucuronate interconversions
pps00053  Ascorbate and aldarate metabolism
pps00140  Steroid hormone biosynthesis
pps00830  Retinol metabolism
pps00860  Porphyrin and chlorophyll metabolism
pps00980  Metabolism of xenobiotics by cytochrome P450
pps00982  Drug metabolism - cytochrome P450
pps00983  Drug metabolism - other enzymes
pps01100  Metabolic pathways
pps05204  Chemical carcinogenesis
Module
pps_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100977378
   00053 Ascorbate and aldarate metabolism
    100977378
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100977378
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100977378
   00860 Porphyrin and chlorophyll metabolism
    100977378
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100977378
   00982 Drug metabolism - cytochrome P450
    100977378
   00983 Drug metabolism - other enzymes
    100977378
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100977378
Enzymes [BR:pps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100977378
Glycosyltransferases [BR:pps01003]
 Others
  Hydrophobic molecule
   100977378
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Nfu_N Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 100977378
NCBI-ProteinID: XP_003805578
Position
4
AA seq 529 aa AA seqDB search
MALKWTSVLLLIHLSCYFSSGSCGKVLVWAAEYSHWMNMKTILKELVQRGHEVTVLASSA
SILFDPNDASTLKFEVYPTSLTKTEFENIIMQQVKRWSDIRKDSFWLYFSQEQEILWELY
DIFRNFCKDVVSNKKLMKKLQESRFDIIFADAFFPCGELLAELFNIPFVYSLFFTRGYTI
ERHSGGLIFPPSYIPIVMSKLSDQMTFMERVKNMIYVLYFDFWFQMCDMKKWDQFYSEVL
GRPTTLFETMGKADIWLMRNSWNFQFPHPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSIISNMTAERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQN
DLLGHPKTRAFITHGGASGIYEAIYHGIPMVGIPLFWDQPDNIAHMKAKGAAVRLDFHTM
SSTDLLNALKTVINDPLYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
RDLTWFQYHSLDVIGFLLACVATVTFIITKCCLFCFWKFTRKVKKEKRD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaaatggacatcagttcttctgctgatacatctcagttgttactttagctct
gggagttgtggaaaggtgctggtgtgggcggcagaatacagccactggatgaatatgaag
acaatcctgaaagagcttgttcagagaggtcatgaggtgactgtactggcatcttcagct
tccattctttttgatcccaatgatgcgtccactcttaaatttgaagtttatcctacatct
ttaactaaaactgaatttgagaatatcatcatgcaacaggttaagagatggtcagacatt
cgaaaagatagcttttggttatatttttcacaagaacaagaaatcctgtgggaattatat
gacatatttagaaacttctgtaaagatgtagtttcaaataagaaacttatgaaaaaacta
caagagtcaagatttgacatcatttttgcagatgctttttttccttgtggtgagctgctg
gctgagctatttaacataccctttgtgtacagtctcttcttcactcgtggctacacaatt
gaaaggcacagtggaggactgattttccctccttcctacatacctattgttatgtcaaaa
ttaagtgatcaaatgactttcatggagagggtaaaaaatatgatctatgtgctttatttt
gacttttggttccaaatgtgtgatatgaagaagtgggatcagttttacagtgaagtttta
ggaagacccactaccttatttgagacaatggggaaagctgacatatggcttatgcgaaac
tcctggaattttcagtttcctcatccattcttaccaaacgttgattttgttggaggactc
cactgcaaacctgccaaacccctacctaaggaaatggaggagtttgtacagagctctgga
gaaaatggtgttgtggtgttttctctggggtcaatcataagtaacatgacagcagaaagg
gccaatgtaatagcaacagccctggccaagatcccacaaaaggttctgtggagatttgat
gggaataaaccagatgccttaggtctcaatactcggctgtacaagtggataccccagaat
gaccttctaggtcatccaaagaccagagcttttataactcatggtggagccagtggcatc
tatgaggcgatctaccatgggatccctatggtgggcattccattgttttgggatcaacct
gataatattgctcacatgaaggccaagggagcagctgttagattggacttccacacaatg
tcgagtacagacttgttgaatgcactgaagacagtaattaatgatcctttatataaagag
aatgttatgaaattatcaagaattcaacatgatcaaccagtgaagcccctggatagagca
gtcttctggattgaatttgtcatgcgccacaaaggagccaaacaccttcgagttgcagcc
cgtgacctcacctggttccagtaccactctttggatgtgattgggtttctgctagcctgt
gtggcaactgtgacatttatcatcacaaagtgttgtctgttttgtttctggaagtttact
agaaaagtgaagaaggaaaaaagagattag

DBGET integrated database retrieval system