KEGG   Pan paniscus (bonobo): 100977496
Entry
100977496         CDS       T02283                                 

Gene name
NUDT18
Definition
(RefSeq) nudix hydrolase 18
  KO
K17817  8-oxo-dGDP phosphatase [EC:3.6.1.58]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pps03400]
    100977496 (NUDT18)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.58  8-oxo-dGDP phosphatase
     100977496 (NUDT18)
DNA repair and recombination proteins [BR:pps03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    100977496 (NUDT18)
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 100977496
NCBI-ProteinID: XP_008975584
UniProt: A0A2R9AIP8
Position
8
AA seq 286 aa
MQPDQAVAGSEDPLSSQDEVLLIQEAKRECRGSWYLPAGRMEPGETIVEALQREVKEEAG
LHCEPETLLSVEERGPSWVRFVFLARPTGGILKTSKEADAESLQAAWYPRTSLPTPLRAH
DILHLVELAAQYRQQARHPLILPQELPCDLVCQRLVATFTSAQTVWVLVGTVGMPHLPVT
ACGLDPMEQRGGMKMAVLRLLQECLTLHHLVVEIKGLLGLQHLGRDHSDGICLNVLVTVA
FRSPGIQDEPPKVRGENFSWWKVMEEDLQSQLLQRLQGSSVVPVNR
NT seq 861 nt   +upstreamnt  +downstreamnt
atgcagccggaccaggctgtggcaggaagtgaggatcctctctcctctcaggatgaggtg
ctactgatccaggaggccaagagggagtgccgggggtcgtggtacctgcctgcggggaga
atggagccaggggagaccatcgtggaggcgctgcagcgggaggtgaaggaggaggcgggg
ctgcactgtgagcccgagacactgctgtccgtggaggagcggggcccctcctgggtccgc
ttcgtgttcctcgctcgccccacaggtggaattctcaagacttccaaggaggccgatgcg
gagtccctgcaggctgcctggtacccacggacctccctgcccactccgctgcgagcccat
gacatcctgcacctggttgaactagccgcccagtatcgccagcaagccaggcaccctctc
attctgccccaagagctaccctgtgatctggtctgccagcggctcgtggctacctttacc
agcgcccagacagtgtgggtgttagtgggcacagtggggatgcctcacttgcctgtcact
gcctgtggcctcgaccctatggagcagaggggtggcatgaagatggccgtcctgcggctg
ctgcaggagtgtctgaccctgcaccacttggtggtggagatcaaggggttgcttggactg
cagcacctgggccgagatcacagtgatggcatctgtttgaatgtgctggtgaccgtggct
tttcggagcccagggatccaggatgaacccccaaaagttcggggtgagaacttctcttgg
tggaaggtgatggaggaagacctgcaaagccagctcctccagcggcttcagggatcctct
gttgtcccagtgaacagatag

DBGET integrated database retrieval system