KEGG   Pan paniscus (bonobo): 100977674
Entry
100977674         CDS       T02283                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01523  Antifolate resistance
pps04010  MAPK signaling pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04064  NF-kappa B signaling pathway
pps04071  Sphingolipid signaling pathway
pps04150  mTOR signaling pathway
pps04210  Apoptosis
pps04217  Necroptosis
pps04350  TGF-beta signaling pathway
pps04380  Osteoclast differentiation
pps04612  Antigen processing and presentation
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04640  Hematopoietic cell lineage
pps04650  Natural killer cell mediated cytotoxicity
pps04657  IL-17 signaling pathway
pps04660  T cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04668  TNF signaling pathway
pps04920  Adipocytokine signaling pathway
pps04930  Type II diabetes mellitus
pps04931  Insulin resistance
pps04932  Non-alcoholic fatty liver disease
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04940  Type I diabetes mellitus
pps05010  Alzheimer disease
pps05014  Amyotrophic lateral sclerosis
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05132  Salmonella infection
pps05133  Pertussis
pps05134  Legionellosis
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05143  African trypanosomiasis
pps05144  Malaria
pps05145  Toxoplasmosis
pps05146  Amoebiasis
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05205  Proteoglycans in cancer
pps05310  Asthma
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05410  Hypertrophic cardiomyopathy
pps05414  Dilated cardiomyopathy
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100977674 (TNF)
   04350 TGF-beta signaling pathway
    100977674 (TNF)
   04064 NF-kappa B signaling pathway
    100977674 (TNF)
   04668 TNF signaling pathway
    100977674 (TNF)
   04071 Sphingolipid signaling pathway
    100977674 (TNF)
   04150 mTOR signaling pathway
    100977674 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100977674 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100977674 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100977674 (TNF)
   04217 Necroptosis
    100977674 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100977674 (TNF)
   04620 Toll-like receptor signaling pathway
    100977674 (TNF)
   04621 NOD-like receptor signaling pathway
    100977674 (TNF)
   04622 RIG-I-like receptor signaling pathway
    100977674 (TNF)
   04625 C-type lectin receptor signaling pathway
    100977674 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    100977674 (TNF)
   04612 Antigen processing and presentation
    100977674 (TNF)
   04660 T cell receptor signaling pathway
    100977674 (TNF)
   04657 IL-17 signaling pathway
    100977674 (TNF)
   04664 Fc epsilon RI signaling pathway
    100977674 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100977674 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100977674 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100977674 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100977674 (TNF)
   05170 Human immunodeficiency virus 1 infection
    100977674 (TNF)
   05161 Hepatitis B
    100977674 (TNF)
   05160 Hepatitis C
    100977674 (TNF)
   05171 Coronavirus disease - COVID-19
    100977674 (TNF)
   05164 Influenza A
    100977674 (TNF)
   05168 Herpes simplex virus 1 infection
    100977674 (TNF)
   05163 Human cytomegalovirus infection
    100977674 (TNF)
   05169 Epstein-Barr virus infection
    100977674 (TNF)
   05165 Human papillomavirus infection
    100977674 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100977674 (TNF)
   05135 Yersinia infection
    100977674 (TNF)
   05133 Pertussis
    100977674 (TNF)
   05134 Legionellosis
    100977674 (TNF)
   05152 Tuberculosis
    100977674 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100977674 (TNF)
   05144 Malaria
    100977674 (TNF)
   05145 Toxoplasmosis
    100977674 (TNF)
   05140 Leishmaniasis
    100977674 (TNF)
   05142 Chagas disease
    100977674 (TNF)
   05143 African trypanosomiasis
    100977674 (TNF)
  09163 Immune disease
   05310 Asthma
    100977674 (TNF)
   05322 Systemic lupus erythematosus
    100977674 (TNF)
   05323 Rheumatoid arthritis
    100977674 (TNF)
   05321 Inflammatory bowel disease
    100977674 (TNF)
   05330 Allograft rejection
    100977674 (TNF)
   05332 Graft-versus-host disease
    100977674 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100977674 (TNF)
   05014 Amyotrophic lateral sclerosis
    100977674 (TNF)
   05020 Prion disease
    100977674 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    100977674 (TNF)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100977674 (TNF)
   05418 Fluid shear stress and atherosclerosis
    100977674 (TNF)
   05410 Hypertrophic cardiomyopathy
    100977674 (TNF)
   05414 Dilated cardiomyopathy
    100977674 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100977674 (TNF)
   04940 Type I diabetes mellitus
    100977674 (TNF)
   04932 Non-alcoholic fatty liver disease
    100977674 (TNF)
   04931 Insulin resistance
    100977674 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100977674 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100977674 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100977674 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100977674 (TNF)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Tumor necrosis fators
   100977674 (TNF)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Cytokines
   100977674 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 100977674
NCBI-ProteinID: XP_003831637
UniProt: A0A2R8ZGR1
Position
6
AA seq 233 aa
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcgctccccaagaag
acaggggggccccagggctccaggcggtgcttgttcctcagcctcttctccttcctgatc
gtggcaggcgccaccacgctcttctgcctgctgcactttggagtgatcggcccccagagg
gaagagttccccagggacctctctctaatcagccctctggcccaggcagtcagatcatct
tctcgaaccccgagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgagggg
cagctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtggagctgaga
gataaccagctggtggtgccatcagagggcctgtacctcatctactcccaggtcctcttc
aagggccaaggctgcccctccacccatgtgctcctcacccacaccatcagccgcatcgcc
gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagggag
accccagagggggctgaggccaagccctggtatgagcccatctatctgggaggggtcttc
cagctggagaagggtgaccgactcagcgctgagatcaatcggcccgactatctcgacttt
gccgagtctgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system