KEGG   Pan paniscus (bonobo): 100977882
Entry
100977882         CDS       T02283                                 

Gene name
FHL1
Definition
(RefSeq) four and a half LIM domains 1
  KO
K14365  four and a half LIM domains protein 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100977882 (FHL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pps04990]
    100977882 (FHL1)
Domain-containing proteins not elsewhere classified [BR:pps04990]
 LIM domain-containing proteins
  FHL family proteins
   100977882 (FHL1)
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 100977882
NCBI-ProteinID: XP_003812376
UniProt: A0A2R9B5K6
Position
X
AA seq 296 aa
MASHRHSGPSSYKVGTMAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECR
KPIGADSKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPKCKGC
FKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVK
CNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGC
KNPITGFGKGSSVVAYEGQSWHDYCFHCKKCSVNLANKRFVFHQEQVYCPDCAKKL
NT seq 891 nt   +upstreamnt  +downstreamnt
atggcttcccatagacactcaggtccctccagctacaaggtgggcaccatggcggagaag
tttgactgccactactgcagggatcccttgcaggggaagaagtatgtgcaaaaggatggc
caccactgctgcctgaaatgctttgacaagttctgtgccaacacctgtgtggaatgccgc
aagcccatcggtgcggactccaaggaggtgcactataagaaccgcttctggcatgacacc
tgcttccgctgtgccaagtgccttcaccccttggccaatgagacctttgtggccaaggac
aacaagatcctgtgcaacaagtgcaccactcgggaggactcccccaagtgcaaggggtgc
ttcaaggccattgtggcaggagatcaaaacgtggagtacaaggggaccgtctggcacaaa
gactgcttcacctgtagtaactgcaagcaagtcatcgggactggaagcttcttccctaaa
ggggaggacttctactgcgtgacttgccatgagaccaagtttgccaagcattgcgtgaag
tgcaacaaggccatcacatctggaggaatcacttaccaggatcagccctggcatgccgat
tgctttgtgtgtgttacctgctctaagaagctggctgggcagcgtttcaccgctgtggag
gaccagtattactgcgtggattgctacaagaactttgtggccaagaagtgtgctggatgc
aagaaccccatcactgggtttggtaaaggctccagtgtggtggcctatgaaggacaatcc
tggcacgactactgcttccactgcaaaaaatgctccgtgaatctggccaacaagcgcttt
gttttccaccaggagcaagtgtattgccccgactgtgccaaaaagctgtaa

DBGET integrated database retrieval system