KEGG   Pan paniscus (bonobo): 100978010
Entry
100978010         CDS       T02283                                 

Gene name
TP53INP2
Definition
(RefSeq) tumor protein p53 inducible nuclear protein 2
  KO
K21247  tumor protein p53-inducible nuclear protein 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100978010 (TP53INP2)
SSDB
Motif
Pfam: DOR
Other DBs
NCBI-GeneID: 100978010
NCBI-ProteinID: XP_003831876
UniProt: A0A2R8ZCD2
Position
20
AA seq 220 aa
MFQRLTSLFFSTPSPPEDPDCPRAFVSEEDEVDGWLIIDLPDSFAAPPSPGAASAPAGRP
PPAPSLMDESWFVTPPACFTAEGPGLGPARLQSSPLEDLLIEHPSMSVYVTGSTIVLEPG
PPSPLPDAALPDGDLSEGELTPARREPRAARHAAPLPARAALLEKAGQVRRLQRARQRAE
RHALSAKAVQRQNRARESRPRRSKNQSSFIYQPCQRQFNY
NT seq 663 nt   +upstreamnt  +downstreamnt
atgttccagcgcctcaccagcctcttcttcagcaccccctcgccccccgaagaccccgac
tgcccccgcgccttcgtgtcggaggaggatgaagtggatggctggctcatcattgacctg
ccggacagcttcgcggctccaccaagccccggggccgcctctgcccccgcgggccgccct
ccgcccgcgccctccttgatggacgagagctggtttgttacccctcccgcctgttttacg
gcagaggggcctggactcggtcccgcccgcctccagagcagtcccctggaggacctcctc
atcgagcaccccagcatgtccgtttacgtcaccggcagcaccatagtgctagagcccggg
cccccttccccgctcccggacgcggccctgcctgacggcgacctcagcgaaggggaattg
acgcccgcccgccgcgagccgcgggccgcgcgccacgccgctcctctcccagcgcgggcg
gcgctgctggagaaggcgggccaggtgcggcggctgcagcgggcccggcagcgggcagag
cgccacgcgctgagcgccaaggcggtgcagcggcagaaccgagcccgcgagagccgtccg
cgccggtccaagaaccagagcagcttcatctaccagccgtgccagcgccagttcaactac
tga

DBGET integrated database retrieval system