KEGG   Pan paniscus (bonobo): 100978025
Entry
100978025         CDS       T02283                                 

Gene name
EFHC1
Definition
(RefSeq) EF-hand domain containing 1
  KO
K23029  EF-hand domain-containing protein 1
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pps04812]
    100978025 (EFHC1)
   04990 Domain-containing proteins not elsewhere classified [BR:pps04990]
    100978025 (EFHC1)
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     100978025 (EFHC1)
Domain-containing proteins not elsewhere classified [BR:pps04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   100978025 (EFHC1)
SSDB
Motif
Pfam: DUF1126 EF-hand_7 EF-hand_1 EF-hand_6 DUF5580
Other DBs
NCBI-GeneID: 100978025
NCBI-ProteinID: XP_003833200
UniProt: A0A2R8ZBJ6
Position
6
AA seq 640 aa
MVSNPVHGLPFLPGTSFKDSTKTAFHRSQTLGYRNGYAIVRRPTVGIGGDRLQFNQLSQA
ELDELASKAPVLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQV
NIYYYLEDDSMSVIEPVVENSGILQGKLIKRQRLAKNDRGDHYHWKDLNRGINITIYGKT
FRVVDCDQFTQVFLESQGIELNPPEKMALDPYTELRKQPLRKYVTPSDFDQLKQFLTFDK
QVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRMPKV
LVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFG
ITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVL
RYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVD
NPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREA
PAPEAESKQTEKDPGVQELEALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFF
KICESLNVPVDDSLVKELIRMCSHGEGKINYYNFVRAFSN
NT seq 1923 nt   +upstreamnt  +downstreamnt
atggtgtccaatcccgtgcatggcttgccctttcttccgggcacgtcctttaaggactct
acgaaaacagccttccacagaagtcagacgctgggctacaggaacggctatgcaattgtt
cgacgtccaacagttgggataggcggagaccggctccagttcaaccagctgtcccaggct
gagctggatgagttggccagtaaggcaccagtcttaacttacggccaacctaaacaagcc
ccacctgcggattttattcctgcgcatgtggcctttgacaaaaaggtactgaaatttgat
gcctatttccaagaagatgttcctatgtcaactgaggaacagtataggatccgtcaagtg
aacatttactattatctagaagatgacagcatgtctgtcatagagcctgttgtagaaaat
tctggaatccttcaaggcaagttaataaaacgccagcggctagccaagaatgaccggggt
gaccattaccattggaaagacctaaatcgaggaataaacatcacaatttatggcaaaact
ttccgcgttgttgactgtgaccaattcacacaggtatttttagaaagccaaggaattgaa
ttaaatccaccagagaagatggctcttgatccttacactgaactccgaaaacagcctctt
cgtaagtatgtcaccccatcagactttgatcaactcaagcaatttctcacctttgacaaa
caggtccttcgattctatgcaatctgggatgatacagacagcatgtatggtgaatgtcgg
acctacatcattcattactatcttatggatgatacggtggaaattcgagaggtccacgaa
cggaatgatgggagagatcctttcccactcctaatgaaccgccagcgtatgcccaaagtt
ttggtggaaaatgcaaagaacttccctcagtgtgtgctagaaatctctgaccaagaagtg
ttggaatggtatactgctaaagacttcattgttgggaagtcactcactatccttgggaga
actttcttcatttatgattgtgatccatttactcgacggtattacaaagagaagtttgga
atcactgatttaccacgtattgatgtgagcaagcgggaaccacctccagtaaaacaggag
ttgcctccttataatggttttggactagtggaagattctgctcagaattgttttgctctc
attccaaaagctccaaaaaaagatgttattaaaatgctggtgaatgataacaaggtgctt
cgttatttggctgtactggaatcccccatcccagaagacaaagaccgcagatttgtcttc
tcttactttctagctaccgacatgatcagtatctttgagcctcctgttcgcaattctggt
atcattgggggcaagtaccttggcaggactaaagttgttaaaccatactctacagtggac
aaccctgtctactatggccccagtgacttcttcattggtgctgtgattgaagtgtttggt
caccggttcatcatccttgatacagacgagtatgttttgaaatacatggagagcaacgct
gcccagtattcaccagaagcactcgcgtcaattcagaaccatgtccgaaagcgagaagcg
cctgctccagaagcagaaagcaagcaaactgaaaaggatccaggcgtgcaggaattggaa
gcattaatagacacaattcagaagcaactgaaagatcactcatgcaaagacaacattcgt
gaggcatttcaaatttatgacaaggaagcttcaggatatgtggacagagacatgttcttt
aaaatctgtgaatcgcttaatgtcccagtggatgactccttggttaaggagttaatcagg
atgtgctctcatggagaaggcaagattaactactataactttgttcgtgctttctcaaac
tga

DBGET integrated database retrieval system