KEGG   Pan paniscus (bonobo): 100978121Help
Entry
100978121         CDS       T02283                                 

Gene name
HTR6
Definition
(RefSeq) 5-hydroxytryptamine receptor 6
  KO
K04162  5-hydroxytryptamine receptor 6
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04024  cAMP signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100978121 (HTR6)
   04024 cAMP signaling pathway
    100978121 (HTR6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100978121 (HTR6)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100978121 (HTR6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100978121 (HTR6)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    100978121 (HTR6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF1385
Motif
Other DBs
NCBI-GeneID: 100978121
NCBI-ProteinID: XP_003814468
UniProt: A0A2R8ZAV3
Position
1
AA seq 440 aa AA seqDB search
MVPEPGPSANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTPPRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC
RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP
RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP
RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATRDPPLPTRAAAAVNF
FNIDPAEPELRPHLLGIPTN
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggtcccagagccgggcccaagcgccaatagcaccccggcctggggggcagggccgccg
tcggccccggggggcagcggctgggtggcggccgcgctgtgcgtggtcatcgcgctgacg
gcggcggccaactcgctgctgatcgccctcatctgcactcagcccgcgctgcgcaacacg
tccaacttcttcctggtgtcgctgttcacgtctgacctgatggtggggctggtggtgatg
ccgccggccatgctgaacgcgctgtacgggcgctgggtgctggcgcgcggcctctgcctg
ctctggaccgccttcgacgtgatgtgctgcagcgcctccatcctcaacctctgcctcatc
agcctggaccgctacctgctcattctctcgccgctgcgctacaagctgcgcatgacgccc
ccgcgtgccctggcgctagtcctgggcgcctggagcctcgccgctctcgcctcctttctg
cccctgctgctgggctggcacgagctgggccacgcacggccacccgtccctggccagtgc
cgcctgctggccagcctgccttttgtcctcgtggcgtcgggcctcaccttcttcctgccc
tcgggtgccatatgcttcacctactgcaggatcctgctggctgcccgcaagcaggccgtg
caggtggcctccctcaccactggcatggccagtcaggcctcagagacgctgcaggtgccc
aggaccccacgcccaggggtggagtctgctgacagcaggcgtctagccacgaagcacagc
aggaaggccctgaaggccagcctgacgctgggcatcctgctgggcatgttctttgtgacc
tggttgcccttctttgtggccaacatagtccaggccgtgtgcgactgcatctccccaggc
ctcttcgatgtcctcacatggctgggttactgtaacagcaccatgaaccccatcatctac
ccactcttcatgcgggacttcaagcgggcgctgggcaggttcctgccatgtccacgctgt
ccccgggagcgccaggccagcctggcctcgccatcactgcgcacctctcacagcggcccc
cggcccggccttagcctacagcaggtgctgccgctgcccctgccgccggactcagattcg
gactcggacgcaggctcaggcggctcctcgggcctgcggctcacggcccagctgctgctt
cctggcgaggccacccgggaccccccgctgcccaccagggccgctgccgccgtcaatttc
ttcaacatcgaccctgcagagcccgagctgcggccgcatctgcttggcatccccacgaac
tga

DBGET integrated database retrieval system