KEGG   Pan paniscus (bonobo): 100978176
Entry
100978176         CDS       T02283                                 

Gene name
GFAP
Definition
(RefSeq) glial fibrillary acidic protein
  KO
K05640  glial fibrillary acidic protein
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100978176 (GFAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100978176 (GFAP)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pps04812]
    100978176 (GFAP)
Membrane trafficking [BR:pps04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    100978176 (GFAP)
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     100978176 (GFAP)
SSDB
Motif
Pfam: Filament Filament_head DUF1664 GAS T6PP_N
Other DBs
NCBI-GeneID: 100978176
NCBI-ProteinID: XP_003806562
UniProt: A0A2R9CBF8
Position
17
AA seq 432 aa
MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNA
GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL
RELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEAT
LARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRT
QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR
GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD
IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV
IKESKQEHKDVM
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggagaggagacgcatcacctccgctgctcgccgctcctacgtctcctcaggggagatg
atggtggggggcctggctcctggccgccgtctgggtcctggcacccgcctctccctggct
cgaatgccccctccactcccgacccgggtggatttctccctggccggggcactcaatgct
ggcttcaaggagacccgggccagtgagcgggcagagatgatggagctcaatgaccgcttt
gccagctacatcgagaaggttcgcttcctggaacagcaaaacaaggcgctggctgctgag
ctgaaccagctgcgggccaaggagcccaccaagctggcagacgtctaccaggctgagctg
cgagagctgcggctgcggctcgatcaactcaccgccaacagcgcccggctggaggttgag
agggacaatctggcacaggacctggccactgtgaggcagaagctccaggatgaaaccaac
ctgaggctggaagccgagaacaacctggctgcctatagacaggaagcagatgaagccacc
ctggcccgtctggatctggagaggaagattgagtcgctggaggaggagatccggttcttg
aggaagatccacgaggaggaggttcgggaactccaggagcagctggcccgacagcaggtc
catgtggagcttgacgtggccaagccagacctcaccgcagccctgaaagagatccgcacg
cagtatgaggcaatggcgtccagcaacatgcatgaagccgaggagtggtaccgctccaag
tttgcagacctgacagacgctgctgcccgcaacgcggagctgctccgccaggccaagcac
gaagccaacgactaccggcgtcagttgcagtccttgacctgcgacctggagtctctgcgc
ggcacgaacgagtccctggagaggcagatgcgcgagcaggaggagcgccacgtgcgggag
gcggccagttatcaggaggcgctggcgcggctggaggaagaggggcagagcctcaaggac
gagatggcccgccacttgcaggagtaccaggacctgctcaatgtcaagctggccctggac
atcgagatcgccacctacaggaagctgctagagggcgaggagaaccggatcaccattccc
gtgcagaccttctccaacctgcagattcgagaaaccagcctggacaccaagtctgtgtca
gaaggccacctcaagaggaacatcgtggtgaagaccgtggagatgcgggatggagaggtc
attaaggagtccaagcaggagcacaaggatgtgatgtga

DBGET integrated database retrieval system