KEGG   Pan paniscus (bonobo): 100978194
Entry
100978194         CDS       T02283                                 

Gene name
SYK
Definition
(RefSeq) spleen associated tyrosine kinase
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04064  NF-kappa B signaling pathway
pps04072  Phospholipase D signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04380  Osteoclast differentiation
pps04611  Platelet activation
pps04613  Neutrophil extracellular trap formation
pps04625  C-type lectin receptor signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps05152  Tuberculosis
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
pps05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100978194 (SYK)
   04072 Phospholipase D signaling pathway
    100978194 (SYK)
   04151 PI3K-Akt signaling pathway
    100978194 (SYK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100978194 (SYK)
   04613 Neutrophil extracellular trap formation
    100978194 (SYK)
   04625 C-type lectin receptor signaling pathway
    100978194 (SYK)
   04650 Natural killer cell mediated cytotoxicity
    100978194 (SYK)
   04662 B cell receptor signaling pathway
    100978194 (SYK)
   04664 Fc epsilon RI signaling pathway
    100978194 (SYK)
   04666 Fc gamma R-mediated phagocytosis
    100978194 (SYK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100978194 (SYK)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100978194 (SYK)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100978194 (SYK)
   05168 Herpes simplex virus 1 infection
    100978194 (SYK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100978194 (SYK)
   05169 Epstein-Barr virus infection
    100978194 (SYK)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100978194 (SYK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100978194 (SYK)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100978194 (SYK)
Protein kinases [BR:pps01001]
 Non-receptor tyrosine kinases
  SYK family
   100978194 (SYK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 Kdo ABC1
Other DBs
NCBI-GeneID: 100978194
NCBI-ProteinID: XP_003808402
UniProt: A0A2R9BI29
Position
9
AA seq 635 aa
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGKK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKSSPAQGNRQESTVSFNPYEPELAPWAAEKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
NT seq 1908 nt   +upstreamnt  +downstreamnt
atggccagcagcggcatggctgacagcgccaaccacctgcccttctttttcggcaacatc
acccgggaggaggcagaagattacctggtccaggggggcatgagtgatgggctttatttg
ctgcgccagagccgcaactacctgggcggcttcgccctgtccgtggcccacgggaagaag
gcacaccactacaccatcgagcgggagctgaatggcacctacgccatcgctggtggcagg
acccatgccagccctgccgacctctgccactaccactcccaggagtctgatggcctggtc
tgcctcctcaagaagcccttcaaccggccccaaggggtgcagcccaagactgggcccttt
gaggatttgaaggaaaacctcatcagggaatatgtgaagcagacatggaacctgcagggt
caggctctggagcaggccatcatcagtcagaagcctcagctggagaagctgatcgctacc
acagcccatgaaaaaatgccttggttccatggaaaaatctctcgggaagaatctgagcaa
attgtcctgataggatcaaagacaaatggaaagttcctgatccgagccagagacaacaat
ggctcctacgccctgtgcctgctgcacgaagggaaggtgctgcactatcgcatcgacaaa
gacaagacagggaagctctccatccccgagggaaagaagttcgacacgctctggcagcta
gtcgagcattattcttataaagcagatggtttgttaagagttcttactgtcccatgtcaa
aaaatcggcacacagggaaatgttaattttggaggccgtccacaacttccaggttcccat
cctgcgacttggtcagcgggtggaataatctcaagaatcaaatcatactccttcccaaag
cctggccacagaaagtcctcccctgcccaagggaaccggcaagagagtactgtgtcattc
aatccgtatgagccagaacttgcaccctgggctgcagaaaaaggcccccagagggaagcc
ctacccatggacacagaggtgtacgagagcccctacgcggaccccgaggagatcaggccc
aaggaggtttacctggaccgaaagctgctgacgctggaagacaaagaactgggctctggt
aattttggaactgtgaaaaagggctactaccaaatgaaaaaagttgtgaaaaccgtggct
gtgaaaatactgaaaaacgaggccaatgaccccgctcttaaagatgagttattagcagaa
gcaaatgtcatgcagcagctggacaacccgtacatcgtgcgcatgattgggatatgcgag
gccgagtcctggatgctggttatggagatggcagaacttggtcccctcaataagtatttg
cagcagaacagacatgtcaaggataagaacatcatagaactggttcatcaggtttccatg
ggcatgaagtacttggaggagagcaattttgtgcacagagatctggctgcaagaaatgtg
ttgctagttacccaacattacgccaagatcagtgatttcggactttccaaagcactgcgt
gctgatgaaaactactacaaggcccagacccatggaaagtggcctgtcaagtggtacgct
ccggaatgcatcaactactacaagttctccagcaaaagcgatgtctggagctttggagtg
ttgatgtgggaagcattctcctatgggcagaagccatatcgagggatgaaaggaagtgaa
gtcaccgctatgttagagaaaggagagcggatggggtgccctgcagggtgtccaagagag
atgtacgatctcatgaatctgtgctggacatacgatgtggaaaacaggcccggattcgca
gcagtggaactgcggctgcgcaattactactatgacgtggtgaactaa

DBGET integrated database retrieval system