KEGG   Pan paniscus (bonobo): 100978200
Entry
100978200         CDS       T02283                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00230  Purine metabolism
pps01100  Metabolic pathways
pps01522  Endocrine resistance
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04072  Phospholipase D signaling pathway
pps04114  Oocyte meiosis
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04371  Apelin signaling pathway
pps04540  Gap junction
pps04611  Platelet activation
pps04713  Circadian entrainment
pps04714  Thermogenesis
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04727  GABAergic synapse
pps04742  Taste transduction
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04913  Ovarian steroidogenesis
pps04914  Progesterone-mediated oocyte maturation
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04921  Oxytocin signaling pathway
pps04923  Regulation of lipolysis in adipocytes
pps04925  Aldosterone synthesis and secretion
pps04926  Relaxin signaling pathway
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps04976  Bile secretion
pps05032  Morphine addiction
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05200  Pathways in cancer
pps05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100978200 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100978200 (ADCY4)
   04371 Apelin signaling pathway
    100978200 (ADCY4)
   04020 Calcium signaling pathway
    100978200 (ADCY4)
   04072 Phospholipase D signaling pathway
    100978200 (ADCY4)
   04024 cAMP signaling pathway
    100978200 (ADCY4)
   04022 cGMP-PKG signaling pathway
    100978200 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100978200 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100978200 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100978200 (ADCY4)
   04062 Chemokine signaling pathway
    100978200 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    100978200 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    100978200 (ADCY4)
   04912 GnRH signaling pathway
    100978200 (ADCY4)
   04913 Ovarian steroidogenesis
    100978200 (ADCY4)
   04915 Estrogen signaling pathway
    100978200 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    100978200 (ADCY4)
   04921 Oxytocin signaling pathway
    100978200 (ADCY4)
   04926 Relaxin signaling pathway
    100978200 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    100978200 (ADCY4)
   04918 Thyroid hormone synthesis
    100978200 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    100978200 (ADCY4)
   04916 Melanogenesis
    100978200 (ADCY4)
   04925 Aldosterone synthesis and secretion
    100978200 (ADCY4)
   04927 Cortisol synthesis and secretion
    100978200 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100978200 (ADCY4)
   04270 Vascular smooth muscle contraction
    100978200 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    100978200 (ADCY4)
   04971 Gastric acid secretion
    100978200 (ADCY4)
   04972 Pancreatic secretion
    100978200 (ADCY4)
   04976 Bile secretion
    100978200 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100978200 (ADCY4)
   04727 GABAergic synapse
    100978200 (ADCY4)
   04725 Cholinergic synapse
    100978200 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    100978200 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    100978200 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    100978200 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    100978200 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    100978200 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100978200 (ADCY4)
   04714 Thermogenesis
    100978200 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100978200 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    100978200 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100978200 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100978200 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100978200 (ADCY4)
   05163 Human cytomegalovirus infection
    100978200 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100978200 (ADCY4)
Enzymes [BR:pps01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100978200 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N DUF3180 CD52
Other DBs
NCBI-GeneID: 100978200
NCBI-ProteinID: XP_008959521
UniProt: A0A2R9BN50
Position
14
AA seq 1077 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQV
SYFLFVIFTAYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAQEMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMTR
YLESWGAAKPFAHLSHGDSPVSTSTPLPEKTLASFSTQWSLDRSRTPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLILFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRP
GLRIALGTTTILLVFAMAITSLFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPY
SMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSECLIVRLYLGPLDS
RPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAMALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagcccccggccgccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccgctgctgctgctgctgctggggatcgtgctctgtgcg
ctcgcggcgctgctcgccgtggcctgggccagcggcagggagctgacctcagacccgagc
ttcctgaccactgtgctgtgcgcgctgggcggcttctcgctgctgctgggcctcgcttcc
cgggagcagcgactgcagcgctggacgcgtcccctgtccggcttggtatgggtcgcgctg
ctagcgctaggccacgccttcctgttcaccgggggcgtggtgagcgcctgggaccaggtg
tcctattttctcttcgtcatcttcacggcgtatgccatgctgcccttgggcatgcgggac
gccgccgtcgcgggcctcgcctcctcactctcgcatctgctggtcctcgggctgtatctt
gggccacagccggactcacggcctgcactgctgccgcagttggcagcaaacgcagtgctg
ttcctgtgcgggaacgtggcaggagtgtaccacaaggcgctgatggagcgcgccctgcgg
gccacgttccgggaggcactcagctccctgcactcacgccggcggctggacaccgagaag
aaacaccaggaacaccttctcttgtccatccttcctgcctacctggcccaagagatgaag
gcagagatcatggcacggctgcaggcaggacaggggtcacggccagagagcactaacaat
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacacggctggccagcgagtgttcccctaaggagctggtgctcatgctcaatgag
ctctttggcaagttcgaccagattgccaaggagcatgaatgcatgcggatcaagatcctg
ggggactgttactactgtgtctctgggctgccactctcactgccagaccatgccatcaac
tgcgtgcgcatgggcctggacatgtgccgggccatcaggaaactgcgggcagccactggc
gtggacatcaacatgcgtgtgggcgtgcactcaggcagcgtactgtgtggagtcatcggg
ctgcagaagtggcagtacgacgtttggtcccatgatgtcacactggctaaccacatggag
gcaggcggtgtaccagggcgagtgcacatcacaggggctaccctggccctgctggcaggg
gcttatgctgtggaggacgcaggcatggagcatcgggacccctaccttcgggagctaggg
gagcctacctatctggtcatcgatccacgggcagaggaggaggatgagaagggcactgca
ggaggcttgctgtcctcgcttgagggcctcaagatgcgtccatcactgctgatgacccgt
tacctggagtcctggggcgcagccaagccttttgcccacctgagccacggagacagccct
gtgtccacctccacccctctcccggagaagaccctggcttccttcagcacccagtggagc
ctggatcggagccgtaccccccggggactagatgatgaactggacaccggggatgccaag
ttcttccaggtcattgagcagctcaactcgcagaaacagtggaagcagtcgaaggacttc
aaccccctgacactgtacttcagagagaaggagatggagaaagagtaccgactctctgca
atccccgccttcaaatactatgaagcctgcaccttcctggtttttctctccaacttcatc
atccagatgctagtgacaaacaggcccccagctctggccatcacgtatagcatcaccttc
ctcctcttcctcctcatcctttttgtctgcttctcagaggacctgatgaggtgtgtcctg
aaaggccccaagatgctgcactggctgcctgcactgtctggcctggtggccacacgacca
ggactgagaatagccttgggcaccaccaccatcctccttgtctttgccatggccattacc
agcctgttcttcttcccaacatcatcagactgccctttccaagctcccaatgtgtcctcc
atgatttccaacctctcctgggagctccctgggtctctgcctctcatcagtgtcccatac
tccatgcactgctgcacgctgggcttcctctcctgctccctctttctgcacatgagcttc
gagctgaagctgctgctgctcctgctgtggctggcggcatcctgctccctcttcctgcac
tcccacgcctggctgtccgaatgcctcatcgtccgcctctatctgggccccttggactcc
aggcccggagtgctgaaggagcccaaactgatgggtgctatctccttcttcatcttcttc
ttcaccctccttgtcctggctcgccagaatgagtactactgccgcctggacttcctgtgg
aagaagaagctgaggcaggagagggaggagacagagacgatggagaacctgactcggctg
ctcttggagaacgtgctccctgcacacgtggccccccagttcattggccagaaccggcgc
aacgaggatctctaccaccagtcctatgaatgcgtttgtgtcctcttcgcctcagtccca
gacttcaaggagttctactctgaatccaacatcaatcatgagggcctagagtgtctgagg
ctgctcaatgagataattgctgattttgatgagctgctctccaagcccaagttcagtggg
gtggagaagatcaagaccatcggcagcacctacatggcagccacaggcttaaatgccacc
tctggacaggatgcacaacaggatgctgaacggagctgcagccaccttggcactatggtg
gaatttgccatggccctggggtctaagctggacgtcatcaacaagcattcattcaacaac
ttccgcctgcgagtggggttgaaccatggacccgtagtagctggagttattggggcccag
aagccgcaatatgacatttggggcaacacagtgaacgtggccagccgcatggagagtaca
ggagtccttggcaaaatccaagtgactgaggagacagcatgggccctacagtccctgggc
tacacctgctacagccggggtgtcatcaaggtgaaaggcaaagggcagctctgcacctac
ttcctgaacacagacttgacacgaactggacctccttcagctaccctaggctga

DBGET integrated database retrieval system