KEGG   Pan paniscus (bonobo): 100978284Help
Entry
100978284         CDS       T02283                                 

Gene name
ATP2B3
Definition
(RefSeq) ATPase plasma membrane Ca2+ transporting 3
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04261  Adrenergic signaling in cardiomyocytes
pps04925  Aldosterone synthesis and secretion
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04970  Salivary secretion
pps04972  Pancreatic secretion
pps04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100978284 (ATP2B3)
   04024 cAMP signaling pathway
    100978284 (ATP2B3)
   04022 cGMP-PKG signaling pathway
    100978284 (ATP2B3)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100978284 (ATP2B3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100978284 (ATP2B3)
  09154 Digestive system
   04970 Salivary secretion
    100978284 (ATP2B3)
   04972 Pancreatic secretion
    100978284 (ATP2B3)
   04978 Mineral absorption
    100978284 (ATP2B3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100978284 (ATP2B3)
Enzymes [BR:pps01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     100978284 (ATP2B3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 100978284
NCBI-ProteinID: XP_003804897
UniProt: A0A2R8ZZC5
Position
X
AA seq 1220 aa AA seqDB search
MGDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEEAYGDVSGLC
RRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIV
SLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEK
QFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKID
ESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEE
KKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANAPKKEKSVL
QGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFII
GVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTT
NRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVG
NKTECALLGFVLDLKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKG
ASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDFSAGQEPD
WDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCG
IIQPGEDFLCLEGKEFNRRIRNEKGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDS
TTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVM
WGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALA
TEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAP
LHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVI
VQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQLKCLKEAGHGPGKDEMTD
EELAEGEEEIDHAERELRRGQILWFRGLNRIQTQIRVVKAFRSSLYEGLEKPESKTSIHN
FMATPEFLINDYTHNIPLIDDTDVDENEERLRAPPPPSPNQNNNAIDSGIYLTTHVTKSA
TSSVFSSSPGSPLHSVETSL
NT seq 3663 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacatggccaatagttccatcgagttccaccccaagccccagcagcagcgggat
gtcccccaggctggaggctttgggtgcacgctggcggagctgcgcaccctcatggagctg
cgaggggccgaggcgctgcagaagatcgaggaggcctacggggatgtcagcgggctctgc
cggaggctgaagacctcacccacagagggcctggcggacaacaccaatgacctggagaag
cgcaggcagatctacgggcagaacttcatccccccaaagcaacccaagaccttcctgcag
ctggtgtgggaggccctgcaggacgtgaccctcatcatcctggaggtggctgccatcgtc
tctctgggcctctcgttctatgcgccgccaggagaggagagtgaagcctgtgggaatgtg
tcgggaggcgcagaagatgagggcgaggccgaagctggctggatcgagggggctgccatc
ctgctgtccgtcatctgtgtggtgctggtcacggccttcaatgactggagcaaggagaag
cagttccgaggcctgcagagccgaattgagcaggagcagaagttcacggtcatccggaac
gggcagctcctccaggtccccgtggctgcgctggtggtgggggacattgcccaggtcaag
tacggcgacctgctgccagccgacggcgtgctcatccaggccaatgacctcaagatcgac
gagagctccctgacgggcgagtctgaccacgtgcgcaagtcagctgacaaagatcccatg
ctgctctcaggcactcatgtcatggaaggttctggaagaatggtggtgaccgccgttggc
gtgaattcccagacaggcatcatcttcacgctgcttggagctggcggagaggaggaagag
aagaaagataagaaaggcaagcagcaggatggggccatggagagtagccagaccaaagct
aagaagcaggatggtgcagtggccatggagatgcagcccctgaagagcgcggagggtggg
gagatggaggagcgggagaagaagaaagccaacgcacccaagaaggagaagtctgtcctt
caggggaagctcacaaagctagccgtgcagatcgggaaagcagggctggtgatgtctgcc
atcaccgtcatcatcctggtcctctactttgtgattgagacgtttgtcgtggaaggccgg
acatggctggcagagtgcacgccggtctatgtacaatacttcgtgaagttcttcatcatt
ggtgtcactgtgctggtcgtggctgtcccagagggcctgcctcttgctgtcaccatctcc
ttagcttactctgtcaagaaaatgatgaaagacaacaacctggtgcgccacctggatgcc
tgcgagaccatgggcaacgccacagccatctgctccgacaagacgggcacgctcaccacc
aaccgtatgaccgtggtccagtcctacctaggggacacccactacaaagagattccggcc
cccagcgccctgacccctaagatcctcgacctcctggtccatgccatctccatcaacagt
gcctataccaccaaaatactacctcctgagaaggaaggcgccctcccacgccaggtgggc
aataagacagagtgcgccctgctgggcttcgtcttggacctgaagcgggacttccagccc
gtgcgcgagcagatcccagaagacaagctttacaaagtgtacaccttcaactcggtccgc
aagtccatgagcacagtcatccgcatgcccgacggtggcttccgcctcttcagcaagggg
gcctcagagatcctgttgaaaaagtgcaccaacatcttgaacagcaatggcgaactccgg
ggctttcggcctcgggaccgggacgacatggtgaggaagatcatcgagccgatggcttgc
gatggcctccgcaccatctgcatcgcctaccgggacttctctgcaggccaggagcccgac
tgggacaacgagaatgaggtcgtgggtgacctcacctgcatagctgtcgtgggcattgag
gaccctgtgcggcccgaggtccctgaagctatccgaaaatgccagcgtgctggcatcaca
gtccgcatggtgactggggacaacatcaacacggcccgggccatcgcagccaaatgtggc
atcatccagcccggggaggacttcctgtgcctagaagggaaggagttcaaccggcggatc
cgcaatgagaaaggcgagatagaacaggagcggctggacaaggtgtggcccaagctgagg
gtgctggcccggtcgtctcccaccgacaagcacacactggtcaaagggattatcgacagc
accactggtgagcagcggcaggtggtggctgtgacgggggatggcaccaacgatgggccg
gccctcaagaaggcggacgtgggcttcgccatgggcatcgcagggaccgacgtggccaag
gaggcctccgacatcatcttgaccgatgacaacttcaccagcatcgtcaaggcagtcatg
tggggccgtaacgtctatgacagcatctccaagttcctgcagtttcaactgacggtcaat
gtggtggctgtgatcgtggccttcacaggtgcctgcattactcaggactctcctctcaaa
gccgtgcagatgttgtgggtgaacttgatcatggacacgtttgcctctctggccctggcg
acggagccacccacagagtcgctgctgctgcggaagccgtacggccgcgacaagcccctc
atctcccgcaccatgatgaagaacattctgggccacgccgtgtaccagctcgccatcatc
ttcaccctgctgtttgtcggggagctcttcttcgacatcgacagcgggaggaatgcgccc
ctgcactcgccaccctcagagcactacaccatcatcttcaacacgttcgtcatgatgcag
ctctttaacgagatcaacgcccgcaagatccacggcgagaggaacgtgttcgacggcatc
ttcagcaaccccatcttctgcaccatcgttttgggcactttcgggattcagattgtcatc
gtccagttcggcgggaagcccttcagctgctccccactatccacagaacagtggctctgg
tgcctgtttgttggtgttggggagctggtctggggacaggtcattgccaccatccccacc
agccagctcaagtgcctgaaggaagccgggcacgggcccgggaaggacgagatgaccgac
gaggagctggccgaaggcgaggaagagatcgaccacgccgagcgggagctccgcaggggc
cagatcctctggttccggggcctgaaccggattcagacgcagatccgggtggtgaaagcg
ttccgtagctcgctctatgaaggcctggagaaaccagaatccaagacctccattcacaac
ttcatggccacgcccgagtttctgatcaatgactacacccacaacatcccgctcattgac
gacacggacgtggacgagaacgaggagcgcctccgggcccccccgcccccgtcccccaac
cagaacaacaacgccatagacagcggcatctacctgaccacgcatgtcaccaagtcagct
acctcttcagtgttttcctccagtcccgggagcccgctccacagcgtggagacgtccctc
taa

DBGET integrated database retrieval system