KEGG   Pan paniscus (bonobo): 100978293
Entry
100978293         CDS       T02283                                 

Gene name
SOCS5
Definition
(RefSeq) suppressor of cytokine signaling 5
  KO
K04698  suppressor of cytokine signaling 5
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04630  JAK-STAT signaling pathway
pps04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100978293 (SOCS5)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100978293 (SOCS5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pps04121]
    100978293 (SOCS5)
Ubiquitin system [BR:pps04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100978293 (SOCS5)
SSDB
Motif
Pfam: SOCS SH2 SOCS_box BRCT_assoc
Other DBs
NCBI-GeneID: 100978293
NCBI-ProteinID: XP_003822711
UniProt: A0A2R8Z6J6
Position
2A
AA seq 536 aa
MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRCLSVKEKNISIGDSTPQQQSSPLR
ENIALQLGLSPSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDADKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggataaagtgggaaaaatgtggaataacttcaaatacaggtgtcagaatctcttcggt
catgagggaggaagccgtagtgaaaatgtggacatgaactccaacagatgtttgtctgtc
aaagagaaaaacatcagcataggagactcaactcctcagcaacaaagcagtcccttaaga
gaaaatattgccttacaactgggattaagcccttcaaagaattcttcaaggagaaatcaa
aattgtgccacagaaatccctcaaattgttgaaataagcatcgaaaaggataatgattct
tgtgttaccccaggaacaagacttgcacgaagagattcctactctcgacatgctccatgg
ggtgggaagaaaaaacattcctgttctacaaagacccagagttcattggatgctgataaa
aagtttggtagaactcgaagtggacttcaaaggagagagaggcgctacggcgtaagttct
gtacacgacatggacagtgtttccagcagaactgtaggaagtcgctctctaagacagagg
ttgcaggatactgtgggcttgtgttttcccatgagaacttacagcaagcagtcaaagcct
ctcttttccaataaaagaaaaatccatctctctgaattaatgcttgagaaatgccctttt
cctgctggctcagatttagcccaaaaatggcatttgattaaacagcatacagctcctgtg
agcccacattcaacattttttgatacatttgatccatctttggtttctacagaagatgaa
gaagataggcttagagagagaaggcggcttagtattgaagaaggggttgatccccctccc
aatgcacaaatacatacatttgaagctactgcacaggttaatccattatataaactggga
ccaaagttagctcctggaatgactgaaataagtggggacagttcggcaattccacaagct
aattgtgactcggaagaggatacaaccaccctgtgtttgcagtcacggaggcagaagcag
cgtcagatatctggagacagccatacccatgttagcagacagggagcttggaaagtccac
acacagattgattacatacactgcctcgtgcctgatttgcttcaaattacagggaatccc
tgttactggggagtgatggaccgttatgaagcagaagcccttctcgaagggaaacctgaa
ggcacgtttttgctcagggactctgcgcaagaggactacctcttctctgtgagcttccgc
cgctacaacagatccctgcatgcccgaattgagcagtggaatcacaactttagtttcgat
gcccatgacccgtgtgtatttcactcctccactgtaacgggacttttagaacattataaa
gatcccagttcgtgcatgttttttgaaccattgcttactatatcactaaataggactttc
ccttttagcctgcagtatatctgtcgcgcggtaatctgcaggtgcactacgtatgatgga
attgatgggctccctctaccctcaatgttacaggattttttaaaagagtatcattataaa
caaaaagttagagttcgctggttggaacgagaaccagtcaaggcaaagtaa

KEGG   Pan paniscus (bonobo): 100978589
Entry
100978589         CDS       T02283                                 

Gene name
SOCS3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04120  Ubiquitin mediated proteolysis
pps04380  Osteoclast differentiation
pps04630  JAK-STAT signaling pathway
pps04668  TNF signaling pathway
pps04910  Insulin signaling pathway
pps04917  Prolactin signaling pathway
pps04920  Adipocytokine signaling pathway
pps04930  Type II diabetes mellitus
pps04931  Insulin resistance
pps04932  Non-alcoholic fatty liver disease
pps04935  Growth hormone synthesis, secretion and action
pps05160  Hepatitis C
pps05164  Influenza A
pps05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100978589 (SOCS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100978589 (SOCS3)
   04668 TNF signaling pathway
    100978589 (SOCS3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100978589 (SOCS3)
   04920 Adipocytokine signaling pathway
    100978589 (SOCS3)
   04917 Prolactin signaling pathway
    100978589 (SOCS3)
   04935 Growth hormone synthesis, secretion and action
    100978589 (SOCS3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100978589 (SOCS3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100978589 (SOCS3)
   05164 Influenza A
    100978589 (SOCS3)
   05168 Herpes simplex virus 1 infection
    100978589 (SOCS3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100978589 (SOCS3)
   04932 Non-alcoholic fatty liver disease
    100978589 (SOCS3)
   04931 Insulin resistance
    100978589 (SOCS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pps04121]
    100978589 (SOCS3)
Ubiquitin system [BR:pps04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100978589 (SOCS3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 100978589
NCBI-ProteinID: XP_003818320
UniProt: A0A2R8ZLZ5
Position
17
AA seq 225 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttctactggagcgcagtgaccggcggcgaggcgaacctgctgctc
agtgccgagcccgccggcacctttctgatccgcgacagctcggaccagcgccacttcttc
acgctcagcgtcaagacccagtctgggaccaagaacctgcgcatccagtgtgaggggggc
agcttctctctgcagagcgatccccggagcacgcagcccgtgccccgcttcgactgcgtg
ctcaagctggtgcaccactacatgccgccccctggagccccctccttcccctcgccacct
actgaaccctcctccgaggtgcccgagcagccgtctgcccagccactccctgggagtccc
cccagaagagcctattacatctactccgggggcgagaagatccccctggtgttgagccgg
cccctctcctccaacgtggccactcttcagcatctctgtcggaagaccgtcaacggccac
ctggactcctatgagaaagtcacccagctgccggggcccattcgggagttcctggaccag
tacgatgccccgctttaa

KEGG   Pan paniscus (bonobo): 100979897
Entry
100979897         CDS       T02283                                 

Gene name
SOCS7
Definition
(RefSeq) suppressor of cytokine signaling 7
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04630  JAK-STAT signaling pathway
pps04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100979897 (SOCS7)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100979897 (SOCS7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pps04121]
    100979897 (SOCS7)
Ubiquitin system [BR:pps04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100979897 (SOCS7)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 100979897
NCBI-ProteinID: XP_003846114
Position
17
AA seq 517 aa
WGSGSRGPGVKTVGGGCCPCPCPPQPPPPQPQPPAAAPQAGEDPTETSDALLVLEGLESE
AESLETNSCSEEELSSPGRGGGGGGRLLLQPPGPELPPVPFPLQDLVPLGRLSRGEQQQQ
PQQPPPPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGGSGGGDGTGKRPSGELAAS
AASLTDVGGSAGRELDAGRKPKLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTSPH
PPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRIAPIRA
AESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLV
RDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKN
GKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPL
ISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVEPST
NT seq 1554 nt   +upstreamnt  +downstreamnt
tggggctcgggcagccgggggccgggggtcaagacagtcggtgggggttgctgcccgtgt
ccgtgtccccctcagccgccccctccgcagccccagccgcctgctgccgccccgcaggcc
ggggaggaccccacggaaacgagcgacgcgctgctggtcctggagggcttggaatcggag
gccgagagcctggagactaacagctgctcggaagaggagctcagcagcccgggtcgcgga
ggaggagggggcggccggcttctgctgcagcccccaggccctgaattacctccggtgccc
ttcccgctgcaggacttggtccctctggggcgcctgagtagaggggagcagcagcagcaa
ccgcagcaacctcccccgcccccgcctcctcccgggcccctccggccactcgcgggtcct
tctcggaagggctccttcaaaatccgcctcagtcgcctctttcgcaccaagagctgcaac
ggtggctccggcggtggggatgggaccggcaagaggccttctggagagctggctgcttca
gctgcgagcctgacagacgtgggaggctctgcgggccgggagctggacgcggggaggaaa
cccaagttgacaagaactcaaagtgccttttctccggtctccttcagccccctgttcaca
ggtgaaactgtgtcgcttgtggatgtggacatttctcagcggggcctgacctctccacac
cctccaactccccctcctcctccgagaagaagcctcagcctcctagatgatatcagtggg
acgctgcctacatctgtccttgtggctccgatggggtcttccttgcagtctttcccccta
cctccgcctcctccaccccatgccccagatgcatttccccggattgctcccatccgagca
gctgaatccctgcacagccaacccccacagcacctccagtgtcccctctaccggcctgac
tcgagcagctttgcagccagccttcgagagttggagaagtgtggttggtattgggggcca
atgaattgggaagatgcagagatgaagctgaaagggaaaccagatggttctttcctggta
cgagacagttctgatcctcgttacatcctgagcctcagtttccgatcacagggtatcacc
caccacactagaatggagcactacagaggaaccttcagcctgtggtgtcatcccaagttt
gaggaccgctgtcaatctgttgtagagtttattaagagagccattatgcactccaagaat
ggaaagtttctctatttcttaagatccagggttccaggactgccaccaactcctgtccag
ctgctctatccagtgtcccgattcagtaatgtcaaatccctccagcacctttgcagattc
cggatacgacagctcgtcaggatagatcacatcccagatctcccactgcctaaacctctg
atctcttatatccgaaagttctactactatgatcctcaggaagaggtatacctgtctcta
aaggaagcgcagctcatttccaaacagaagcaagaggtggaaccctccacgtag

KEGG   Pan paniscus (bonobo): 100989242
Entry
100989242         CDS       T02283                                 

Gene name
SOCS2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04630  JAK-STAT signaling pathway
pps04910  Insulin signaling pathway
pps04917  Prolactin signaling pathway
pps04930  Type II diabetes mellitus
pps04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100989242 (SOCS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100989242 (SOCS2)
   04917 Prolactin signaling pathway
    100989242 (SOCS2)
   04935 Growth hormone synthesis, secretion and action
    100989242 (SOCS2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100989242 (SOCS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pps04121]
    100989242 (SOCS2)
Ubiquitin system [BR:pps04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100989242 (SOCS2)
SSDB
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Other DBs
NCBI-GeneID: 100989242
NCBI-ProteinID: XP_008968224
UniProt: A0A2R9C5Q8
Position
12
AA seq 198 aa
MTLRCLQPSRNGGEGTRSQWGTAGSAEEPSPEAARLAKALRELGQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgccttcagccctccaggaatggcggggaagggacgcggagccagtgg
gggaccgcggggtcggcggaggagccatccccggaggcggcgcgtctggcgaaggccctg
cgggagctcggtcagacaggatggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggcaccagaaggaactttcttgattagagatagctcgcattcagactac
ctactaacaatatctgttaaaacatcagctggaccaactaatcttcgaatcgaataccaa
gacggaaaattcagattggactctatcatatgtgtcaaatccaagcttaaacaatttgac
agtgtggttcatctgatcgactactatgttcagatgtgcaaggataagcggacaggtcca
gaagccccccggaacggcactgttcacctttatctgaccaaaccgctctacacgtcagca
ccatctctgcagcatctctgtaggctcaccattaacaaatgtaccggtgccatctgggga
ctgcctttaccaacaagactaaaagattacttggaagaatataaattccaggtataa

KEGG   Pan paniscus (bonobo): 100989690
Entry
100989690         CDS       T02283                                 

Gene name
SOCS4
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04630  JAK-STAT signaling pathway
pps04910  Insulin signaling pathway
pps04917  Prolactin signaling pathway
pps04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100989690 (SOCS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100989690 (SOCS4)
   04917 Prolactin signaling pathway
    100989690 (SOCS4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100989690 (SOCS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pps04121]
    100989690 (SOCS4)
Ubiquitin system [BR:pps04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100989690 (SOCS4)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 100989690
NCBI-ProteinID: XP_003831738
UniProt: A0A2R8ZAJ6
Position
14
AA seq 440 aa
MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEV
SLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINSKSDEWVSTDLSQTELRDGQLKRRN
MEENINCFSHTNVQPCVITTDNALCREGPMTGSVMNLVSNNSIEDSDMDSDDEILTLCTS
SRKRNKPKWELDDEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGL
LEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLK
EYHYKSKVRVLRIDAPEQQC
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcagaaaataatgaaaatattagtaaaaatgtagatgtaaggcccaaaactagtcgg
agcagaagtgccgacagaaaagacggttatgtgtggagtggaaagaagttatcttggtca
aaaaagagtgagagttattcagatgctgagacagtgaatggtatagagaaaaccgaagtg
tctttaaggaaccaagaaaggaagcacagctgttcatccattgagttggacttagatcat
tcctgtgggcatcgatttttaggccgatctcttaaacagaaactgcaagatgccgtgggg
cagtgttttccaataaagaattgtagtagtcggcactcttcagggcttccgtctaaaagg
aaaattcatatcagtgaactcatgttagataagtgtcctttcccacctcgatcagattta
gcctttaggtggcattttattaaacgacacactgctcctataaattccaaatcagatgaa
tgggtaagcacagacttgtctcagactgaattgagggatggtcagctaaaacgaagaaat
atggaagaaaatataaactgtttctcacataccaatgttcagccctgtgtcataaccacc
gacaatgctttgtgtagagaaggtcctatgactggctctgtgatgaacctggtttcaaat
aacagtatagaagatagtgatatggattccgatgatgaaattctaacactttgcacaagt
tccagaaaaagaaacaaacccaaatgggaattggatgatgaaatcctgcagttggaaaca
cctcctaaataccacacgcagattgattatgtccactgtcttgtaccagacctccttcag
atcaataacaacccatgttactggggagtgatggataaatacgcagccgaagcactactg
gaaggaaaaccagagggtacctttttacttcgagactcagcacaggaagactatttattc
tctgttagttttagacgctatagtcgttctcttcatgctagaattgaacagtggaatcac
aactttagctttgatgcacatgacccctgtgtcttccattctcctgacattactgggctc
ctagaacattataaggacccaagcgcctgtatgttctttgaaccacttctatccactccc
ttaattcggactttccctttttccctgcagcatatatgcagaacagttatttgtaactgt
acaacttacgatggcatcgatgcccttccaattccttcttctatgaaattatatctaaag
gaatatcattataaatcaaaagttagagtactcaggattgatgcaccagaacagcaatgc
tag

KEGG   Pan paniscus (bonobo): 100993667
Entry
100993667         CDS       T02283                                 

Gene name
SOCS6
Definition
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04630  JAK-STAT signaling pathway
pps04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100993667 (SOCS6)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100993667 (SOCS6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pps04121]
    100993667 (SOCS6)
Ubiquitin system [BR:pps04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100993667 (SOCS6)
SSDB
Motif
Pfam: SH2 SOCS_box LID
Other DBs
NCBI-GeneID: 100993667
NCBI-ProteinID: XP_003827337
UniProt: A0A2R9AWS5
Position
18
AA seq 535 aa
MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGED
EKGGKNRSKSESLMGTLKRRLSAKQKSKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQR
PIRSTSLRSHHYSPTPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQS
ETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSY
CLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSP
RAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDS
VQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSL
SFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGS
ATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgaagaaaattagtcttaaaaccttacggaaatcttttaacttgaataaaagtaaagaa
gaaactgatttcatggtagtacaacaaccatcgctagccagtgactttggaaaagatgat
tccttatttggtagctgctatggtaaagatatggccagctgcgatatcaacggtgaagat
gaaaaaggcggaaaaaacagatcaaaaagcgagagcctgatgggtacgctaaaaaggcgg
ctttctgcaaaacagaagtcaaaaggcaaggcgggcacaccctctgggagctccgccgac
gaggacaccttctcctcctcctcagcacccatagtctttaaagacgtgagagctcagagg
ccgataaggtccacctcgctccgcagccatcactacagtcccacgccgtggcctctgcgg
cccacaaactccgaggagacctgcatcaagatggaggtgagagtcaaggccttggttcac
tcttccagcccgagtccagccctgaatggcgtccggaaggatttccacgacctccagtct
gagaccacgtgccaggagcaagccaattcactgaagagctcggcttctcataatggagac
ctgcatcttcacctggatgaacatgtgcctgtcgttattggacttatgcctcaggactac
attcagtatactgtgcctttagatgaggggatgtatcctttggaaggatcacggagctat
tgtctggacagctcttctcccatggaagtctctgcggttcctcctcaagtgggagggcgc
gctttccccgaggatgagagtcaggtagaccaggacctagttgtcgccccagagatcttc
gtggatcagtccgtgaatggcttgttgattggcaccacgggagtcatgttgcagagcccg
agagcgggtcacgatgatgtccctccactctcaccattgctacctccaatgcagaataat
caaatccaaaggaacttcagtggactcactggcacagaagcccacgtggctgaaagtatg
cgctgtcatttgaattttgatccgaactctgctcctggggttgcaagagtttatgactca
gtgcaaagtagtggtcccatggttgtgacaagccttacagaggagctgaaaaaacttgca
aagcaaggatggtactggggaccaatcacacgttgggaggcagaagggaagctagcaaac
gtgccagatggttcttttcttgttcgggacagttctgacgaccgttaccttttaagcttg
agctttcgctcccatggtaaaacacttcacactagaattgagcactcaaatggtaggttt
agcttttatgaacagccagatgtggaaggacatacgtccatagttgatctaattgagcat
tcaatcagggactctgaaaatggagctttttgttattcaaggtctcggctgcctggatct
gcaacttaccccgtcagactgaccaacccagtgtcccggttcatgcaggtgcgctcgttg
cagtacctgtgtcgttttgttatacgtcagtataccagaatagacttaattcagaaactg
cctttgccaaacaaaatgaaggattatttacaggagaagcactactga

DBGET integrated database retrieval system