KEGG   Pan paniscus (bonobo): 100978369
Entry
100978369         CDS       T02283                                 

Gene name
CXCL8, IL8
Definition
(RefSeq) C-X-C motif chemokine ligand 8
  KO
K10030  interleukin 8
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04062  Chemokine signaling pathway
pps04064  NF-kappa B signaling pathway
pps04072  Phospholipase D signaling pathway
pps04218  Cellular senescence
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04932  Non-alcoholic fatty liver disease
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps05132  Salmonella infection
pps05133  Pertussis
pps05134  Legionellosis
pps05135  Yersinia infection
pps05142  Chagas disease
pps05144  Malaria
pps05146  Amoebiasis
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05219  Bladder cancer
pps05323  Rheumatoid arthritis
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100978369 (CXCL8)
   04072 Phospholipase D signaling pathway
    100978369 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100978369 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100978369 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100978369 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100978369 (CXCL8)
   04621 NOD-like receptor signaling pathway
    100978369 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    100978369 (CXCL8)
   04657 IL-17 signaling pathway
    100978369 (CXCL8)
   04062 Chemokine signaling pathway
    100978369 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100978369 (CXCL8)
   05202 Transcriptional misregulation in cancer
    100978369 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    100978369 (CXCL8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100978369 (CXCL8)
   05171 Coronavirus disease - COVID-19
    100978369 (CXCL8)
   05164 Influenza A
    100978369 (CXCL8)
   05163 Human cytomegalovirus infection
    100978369 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100978369 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100978369 (CXCL8)
   05135 Yersinia infection
    100978369 (CXCL8)
   05133 Pertussis
    100978369 (CXCL8)
   05134 Legionellosis
    100978369 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100978369 (CXCL8)
   05144 Malaria
    100978369 (CXCL8)
   05142 Chagas disease
    100978369 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100978369 (CXCL8)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100978369 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100978369 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100978369 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100978369 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100978369 (CXCL8)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Chemokines
   100978369 (CXCL8)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Chemokines
   100978369 (CXCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100978369
NCBI-ProteinID: XP_003832383
Position
4
AA seq 99 aa
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
NT seq 300 nt   +upstreamnt  +downstreamnt
atgacttccaagctggccgtggctctcttggcagccttcctgatttctgcagctctgtgt
gaaggtgcagttttgccaaggagtgctaaagaacttagatgtcagtgcataaagacatac
tccaaacctttccaccccaaatttatcaaagaactgagagtgattgagagtggaccacac
tgcgccaatacagaaattattgtaaagctttctgatggaagagagctctgtctggacccc
aaggaaaactgggtgcagagggttgtggagaagtttttgaagagggctgagaattcataa

DBGET integrated database retrieval system