KEGG   Pan paniscus (bonobo): 100978380
Entry
100978380         CDS       T02283                                 

Gene name
CDC42EP3
Definition
(RefSeq) CDC42 effector protein 3
Organism
pps  Pan paniscus (bonobo)
SSDB
Motif
Pfam: BORG_CEP PBD
Other DBs
NCBI-GeneID: 100978380
NCBI-ProteinID: XP_003817692
UniProt: A0A2R8Z776
Position
2A
AA seq 254 aa
MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQ
GNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALML
PLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQ
SSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTGSLLSLQLDLGP
SLLDEVLNVMDKNK
NT seq 765 nt   +upstreamnt  +downstreamnt
atgccagccaagaccccaatttacctgaaagcagccaataacaagaaaggaaagaaattt
aaactgagggacattctgtctcctgatatgatcagtccgccgcttggagactttcgccac
accatccacattggcaaagagggccagcacgatgtctttggagatatttcctttcttcaa
gggaactacgagcttttacctggaaaccaggagaaagcacacctgggccagttccctgga
cataatgagttcttccgggccaacagcacctcagactctgtgttcacagaaacgccctcc
ccggtgctcaaaaatgccatctccctcccgaccattggaggatcccaagctctcatgttg
cccttattgtcaccagtgacatttaattccaaacaggagtccttcgggccagcaaagctg
cccaggcttagctgcgagcccgtcatggaggaaaaagctcaggagaaaagcagtctgttg
gagaacgggacagtccaccagggagacacctcgtggggctccagcggttctgcatctcag
tccagccaaggcagagacagccactcctccagcctgtccgaacagtaccccgactggcca
gccgaggacatgtttgaccatcccaccccatgcgagctcatcaagggaaagactaagtca
gaggagtccctctctgaccttacaggttccctcctctccctgcagcttgatcttgggccc
tcacttttggatgaggtgctgaatgtaatggataaaaataagtaa

DBGET integrated database retrieval system