KEGG   Pan paniscus (bonobo): 100978439Help
Entry
100978439         CDS       T02283                                 

Gene name
GEN1
Definition
(RefSeq) GEN1, Holliday junction 5' flap endonuclease
  KO
K15338  flap endonuclease GEN [EC:3.1.-.-]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pps03400]
    100978439 (GEN1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     100978439 (GEN1)
DNA repair and recombination proteins [BR:pps03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     100978439 (GEN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_I Chromo_2 XPG_N SpoU_methylas_C
Motif
Other DBs
NCBI-GeneID: 100978439
NCBI-ProteinID: XP_003827038
UniProt: A0A2R8ZZ47
Position
2A
AA seq 908 aa AA seqDB search
MGVNDLWQILEPVKQHIPLRNLGGKTIAVDLSLWVCEAQTVKKMMGSVMKPHLRNLFFRI
SYLTQMDVKLVFVMEGEPPKLKADVISKRNQTRYGSSGKSWSQKTGRSHFKSVLRECLHM
LECLGIPWVQAAGEAEAMCAYLNAGGHVDGCLTNDGDTFLYGARTVYRNFTMNTKDPHVD
CYTMSSIKSKLGLDRDALVGLAILLGCDYLPKGVPGVGKEQALKLIQILKGQSLLQRFNR
WNETSCNSSPQLLVTKKLAHCSVCSYPGSPKDHERNGCRLCKSDKYCEPHDYEYCCPCEW
HRTEHDRQLSEVENNIKKKACCCEGFPFHEVIQEFLLNKDKLVKVIRYQRPDLLLFQRFT
LEKMEWPNHYACEKLLVLLTRYDMIERKLGSRNSNQLQPIRIVKTRIRNGVHCFEIEWEK
PEHYAMEDKQHGEFALLTIEEESLFEAAYPEIVAVYQKQKLEIKGKKQKRIKPKENNLPE
PDEVMSFQSHMTLKPTCEIFHKQNSKLNSGISPDPTLPQESISASLNSLLLPKNTPCLNA
QEQFMSSLRPLAIQQIKAVSKSLISESSQPNTSSHNISMIADLHLSTIDWEGTSFSNSPA
IQRNTFSHGLKSEVESELSAIPDGFENIPEQLSCESERYTANIKKVLDEDSDGISPEEHL
LSGVTDLCLQDLPLKERIFIKLSYPQDNLQPDVNLKTLSILSVKESCIANSGSDCTSHLS
KDLPGIPLQNESRDSKILKGDQLLQEDYKVNTSVPYSVSNTVVKTCNVRPPNTALDHSRK
VDMQTTRKILMKKSVCLDRHSSDEQSAPVFGKAKYTTQRMKHSSQKHNSSHFKESGHNKL
SSPKIHIKETEQCVRSYETAENEESCFPDSTKSSLSSLQCHKKENNSGTCLDSPLPLRQR
LKLRFQST
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgaatgacttgtggcaaattttggagcctgttaagcaacacatccccttgcgt
aatcttggtgggaaaaccattgcagttgatctgagtctctgggtgtgtgaggcacagaca
gtcaaaaaaatgatgggcagcgtcatgaagccccacctcaggaacttattttttcgtatc
tcatatttaacacaaatggatgtaaaactggtatttgttatggaaggggaaccaccaaag
ctgaaagctgatgtcataagcaagaggaatcagactcggtatgggtcttctggaaaatcg
tggtctcagaaaacagggagatcacattttaaatcagtcttaagagagtgcctccatatg
ctcgaatgcttaggaatcccctgggttcaggctgctggggaagctgaagccatgtgtgct
tatctcaatgctggtggtcatgtcgatggctgcctcaccaatgatggagatactttcctt
tatggggcccggactgtttacaggaatttcactatgaatacaaaggacccacatgttgac
tgttacacaatgtcatctatcaagagtaaactaggtttggatagagatgctctggttgga
ttagcaatacttcttggttgtgattatctcccaaagggagtccctggagttggaaaagag
caagcattaaaacttatacagattttgaaagggcaaagtttacttcagaggtttaatcgg
tggaatgaaacatcttgtaactctagtccacaactgctagtcactaaaaaactggctcat
tgttctgtgtgttcctatccaggttcacctaaggatcatgaacgtaatggatgcagatta
tgtaaaagtgataaatattgtgagccacatgactatgaatactgctgtccttgtgagtgg
caccgtacagaacatgataggcaactcagtgaagtagagaacaatattaagaagaaagct
tgctgttgtgagggattcccattccatgaggttattcaagaattccttttaaacaaggat
aaattggtgaaggttatcaggtaccaaagacctgatttgttattgtttcagagatttact
cttgaaaaaatggagtggcccaatcactatgcatgtgagaaattgctggtacttttgacc
cgttatgacatgatagaaagaaagcttggtagcagaaactctaatcaactacagccaatt
cgaattgttaagactcgaatcagaaatggagttcattgttttgaaatagaatgggaaaag
cctgaacattatgctatggaagataaacaacatggagaatttgctttattaacaattgag
gaagaatcattgtttgaagcagcatatcctgagatcgttgctgtttaccaaaaacaaaag
ttagaaattaaagggaagaaacaaaaacgtattaagcctaaagaaaacaatttgccagaa
ccagatgaagtaatgagctttcagtcacacatgactttaaaacccacatgtgaaatcttt
cataagcagaattccaagttaaattcggggatttcccctgatcctacattaccacaggaa
tctatttctgcctcattgaatagcttgcttttacctaaaaatactccatgtttgaatgca
caagaacagttcatgtcttctctaagacctttggctatacagcaaattaaagctgtcagt
aagtctctaatttcagaatctagtcaacccaatacctcatctcataatatatccatgatt
gctgatctacacttgagcactattgactgggaaggtacttcttttagtaattctccagct
attcaaaggaatactttttctcatggtttaaaatcagaagttgaatcagagctatcagcc
atccctgatggctttgaaaatatcccagaacaactgtcctgtgaatcagaaaggtacact
gcaaacataaagaaagtgttggatgaggattctgatgggattagtcctgaagagcatcta
ctttctggcgttactgatttatgtcttcaggatttgcctttaaaggaacgaatatttata
aaattatcatatcctcaggataatctacaaccagatgtcaacctgaaaactttgtccata
cttagtgtaaaagaatcttgtattgctaacagtggttctgattgtacatcacatctttca
aaggatcttccaggaattcccttgcaaaatgaatccagagactctaaaattctaaaagga
gaccagctgcttcaagaagactataaagtcaatacttctgtcccttattctgtcagtaac
acagtggtaaagacctgcaatgttagaccaccaaatactgctttagatcatagtagaaaa
gttgatatgcaaaccactcggaaaattttaatgaagaagagtgtttgccttgacagacat
tcctctgatgaacaaagtgccccagtgtttgggaaagctaagtacacaactcaaagaatg
aagcacagttctcaaaagcataattcatcccatttcaaagaaagtggccataacaagttg
agtagccctaagatacatattaaagaaactgaacagtgtgtcagatcttatgaaacagct
gaaaatgaagaaagctgtttcccagattcaacaaaaagttctctgagttctctacaatgt
cataagaaagaaaacaactctggtacttgtttggatagtcctcttcctttacgccagaga
ttaaaactaagattccaaagcacttga

DBGET integrated database retrieval system