KEGG   Pan paniscus (bonobo): 100978521Help
Entry
100978521         CDS       T02283                                 

Gene name
WNK3
Definition
(RefSeq) WNK lysine deficient protein kinase 3
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100978521 (WNK3)
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100978521 (WNK3)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100978521 (WNK3)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: Other
  Wnk family
   100978521 (WNK3)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100978521 (WNK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 100978521
NCBI-ProteinID: XP_003807207
UniProt: A0A2R8ZXM6
Position
X
AA seq 1743 aa AA seqDB search
MATDSGDPASTEDSEKPDGISFENRVPQVAATLTVEARLKEKNSTFSASGETVERKRFFR
KSVEMTEDDKVAESSPKDERIKAAMNIPRVDKLPSNVLRGGQEVKYEQCSKSTSEISKDC
FKEKNEKEMEEEAEMKAVATSPSGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQD
RKLTKAEQQRFKEEAEMLKGLQHPNIVRFYDSWESILKGKKCIVLVTELMTSGTLKTYLK
RFKVMKPKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATL
MRTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRK
VTSGIKPASFNKVTDPEVKEIIEGCIRQNKSERLSIRDLLNHAFFAEDTGLRVELAEEDD
CSNSSLALRLWVEDPKKLKGKHKDNEAIEFSFNLETDTPEEVAYEMVKSGFFHESDSKAV
AKSIRDRVTPIKKTREKKPAGCLEERRDSQCKSMGNVFPQPQNTTLPLAPAQQSGAECEE
TEVDQHVRQQLLQRKPQQHCSSVTGDNLSEAGAASVIHSDTSSQPSVAYSSNQTMGSQMV
SNIPQAEVNVPGQIYSSQQLVGHYQQVSGLQKQPKLTQPQILPLVQGQSTVLPVHVLGPT
VVSQPQVSPLTVQKVPQIKPVSQPVGVEQQAALLKPDLVRSLNQDVATTKENVSSPDNPS
GNGKQDRIKQRRASCPRPEKGTKFQLTVLQVSTSGDNMVECQLETHNNKMVTFKFDVDGD
APEDIADYMVEDNFVLESEKEKFVEELRAIVGQAQEILHVHFATERATGVDSITVDSNSS
QTGSSEQVQINSTSTQTSNESAPQSSPVGRWRFCINQTIRNRETQSPPSLQHSMSAVPGR
HPLPSPKNTSNKEISRDTLLTIENNPCHRALFTSKSEHKDVVDGKISECASVETKQPAIL
YQVEDNRQIMAPVTNSSSYSTTSVRAVPAECEGLTKQASIFIPVYPCHQTASQADALMSH
PGESTQTSGNSLTTLAFDQKPQTLSVQQPAMDAEFISQEGETTVNTEASSPKTVIPTQTP
GLEPTTLQPTTVLESDGERPPKLEFADNRIKTLDEKLRNLLYQEHSISNIYPESQKDTQS
IDSPFSSSAEDTLSCPVTEVIAISHCGIKDSPVQSPNFQHTGSKLLSNVAASQPANISVF
KRDLNVITSVPSELCLHEMSSDASLPGDPEAYPAAVSSGGAIHLQTGVETEEMRSAIAPD
PIPLTRESTADTRALNRCKAMSGSFQRGRFQVITIPQQQSAKMTSFGIEHISVFSETNHS
SEEAFIETAKSQLVEIEPATQNPKTSFSSEKLQALQETCKENKGVPKQGDNFLSFSAACE
TDVSSVTPEKEFEETSATGSSMQSGSELLLKEREILTAGKQPSSDSEFSASLAGSGKSVA
KTGPESNQCLPHHEEQAYAQTQSSLFYSPSSPMSSDDESEIEDEDLKVELQRLREKHIQE
VVNLQTQQNKELQELYERLRSIKDSKTQSTEIPLPPASPRRPRSFKSKLRSRPQSLTHVD
NGIVATDPLCVESNAASCQQSPASKKGMFTDDLHKLVDDWTKEAVGNSLIKPSLNQLKQS
QHKLETENWNKVSENTPSTMGYTSTWISSLSQIRGAVPTSLPQGLSLPSFPGPLSSYGMP
HVCQYNAVAGAGYPVQWVGISGTTQQSVVIPAQSGGPFQPGMNMQAFPSSSVQNPATIPP
GPK
NT seq 5232 nt NT seq  +upstreamnt  +downstreamnt
atggccactgattcaggggatccagccagcacagaagattctgagaaacctgatggaatt
tcatttgaaaacagagttccccaggtcgctgcaactttgacagtagaagctagactaaag
gagaaaaacagtaccttctctgcttctggggaaactgtagaaaggaagagatttttccga
aagagtgttgaaatgacagaagatgacaaagttgccgaatcatcccccaaagatgagaga
attaaggctgcaatgaatattccaagagtagataagcttccttcaaatgtgctgagaggt
ggacaagaagttaaatatgaacagtgttcaaagtcaacctcagaaatctcaaaagattgt
ttcaaggagaaaaatgaaaaggaaatggaagaagaagcagaaatgaaggctgtagctact
tctcctagtggcagattcctgaaatttgacatagaactaggaagaggagcatttaaaaca
gtatataagggactggacactgaaacatgggttgaggttgcttggtgtgagctgcaggac
cgaaagttaaccaaagctgagcagcaaagattcaaggaagaagcagagatgttgaagggt
ctccagcaccccaatatagttcgattttatgattcctgggaatctatattaaaaggaaag
aaatgtattgtattagtgactgaactaatgacatctgggaccttaaagacgtacttaaaa
cgatttaaagtcatgaaaccaaaggtcttaaggagctggtgcaggcaaattttaaagggg
ttgcagttcttgcacactaggactcctcctattattcaccgggatctgaagtgtgacaat
attttcatcacgggacccactggatctgtgaagattggtgatctaggattagccacctta
atgcgtacctcatttgctaagagtgtcattggaactcctgagtttatggctccagagatg
tatgaagaacactatgatgaatccgtagatgtttatgcttttggaatgtgtatgctggaa
atggccacatcggagtatccttattctgagtgtcagaatgcagctcaaatataccggaaa
gtaactagtggcataaaaccagccagcttcaataaagtcactgatcctgaagtcaaagaa
atcattgaaggatgtattcgtcaaaacaaatctgaaaggttgtctatcagggacctatta
aaccatgcattttttgctgaggatacaggactgagggtggagttagcagaagaagatgat
tgctcaaattcatcccttgctttaagactctgggttgaagaccctaaaaaattgaaaggc
aaacacaaagacaatgaagctattgaatttagtttcaacttagaaacagatacacctgag
gaagtagcatatgaaatggtcaagtctgggttcttccatgaaagtgattccaaagctgtt
gctaaatccattagagaccgggtgacaccaataaagaagacaagagagaagaagcctgct
ggctgtttggaagaacgcagggattctcagtgcaagtctatggggaatgtattccctcag
ccccagaatacaactttgccccttgctcccgctcagcaatctggggctgaatgtgaagaa
actgaagttgatcaacatgttagacaacagcttctacaaagaaaaccacagcagcactgc
tcctctgttacaggtgacaatttgtctgaggcaggagctgcatcagttatacattcagat
acttcaagtcagcccagtgtagcctattcctcaaatcaaacgatgggctctcaaatggtt
tctaatatcccgcaggctgaagtaaatgttccagggcaaatttattcatctcaacaacta
gtaggacattaccagcaagtttcagggttacagaagcagccaaagctgactcagccgcag
attttgcctttggttcaaggtcagtccactgttttacctgtacatgtccttggaccgaca
gttgtttcacaaccccaggtttccccattaactgttcagaaggtcccacagataaagcct
gtatcccaaccagttggagttgaacaacaagcagctcttctaaaaccagatttagttcga
agcttgaatcaagatgtggcaactacgaaggaaaacgtcagtagccctgataacccaagt
ggaaatggcaaacaggatcggatcaaacagagaagagcttcctgtccccgaccagagaag
gggactaaatttcagcttaccgtccttcaggtatcaacctctggagataacatggtagag
tgtcagctggagacacacaacaacaagatggtcaccttcaagtttgatgttgatggtgat
gcgccagaggatattgcagactatatggttgaagataactttgtgctggaaagtgagaaa
gaaaaatttgtagaagaattgagagctattgtaggtcaagcccaggagatccttcatgtc
cactttgccacagaaagagccactggagttgattctattactgtggactccaacagtagc
cagacagggtcatctgaacaagtacagataaattctacatctactcaaaccagcaatgaa
tctgctcctcagtcatccccagttggtcggtggcgattctgtatcaatcagacaataaga
aaccgtgagactcagtctcctccttctcttcagcattccatgtctgcggttcctggccga
catccacttcctagtccaaaaaacacaagtaataaggaaatatcacgggacacattgctc
actatagaaaataatccatgccaccgtgcgcttttcacctccaaatcagaacacaaggat
gtggttgatggtaagatttctgaatgtgctagtgtagaaactaagcagccagctatactt
tatcaagtggaagataacaggcagataatggcaccagttactaatagttccagttactct
actacttcagttcgtgcagttccagctgaatgtgagggactcaccaaacaagcaagcata
ttcatacctgtgtatccatgtcaccaaactgccagtcaggctgatgcacttatgtcccat
cctggcgaatcaactcagacttctggtaactctcttacaactctggcatttgatcaaaag
cctcaaaccttatcagtacagcagccagctatggatgcagagtttatttctcaagaagga
gaaactacagtgaacactgaagcaagttctcctaagacagtcattcccactcagacccct
ggccttgaaccaactacccttcaacccactactgtcctggaatcagatggagaaagacct
ccaaaactggagtttgcagacaaccgaattaaaactctggatgaaaaattaagaaacttg
ctctatcaggagcacagcatctctaacatctatcccgagagtcagaaggatacccaaagc
atagactctccattttcttcctctgctgaagataccctctcctgtccagtgacagaagtc
atagccatcagtcactgtggaattaaagatagccctgtacaatcccctaatttccaacac
acaggctctaagcttctgtccaatgtggctgcaagtcagcctgctaatatatcagtgttc
aaaagggacctgaatgtgataacttctgtacccagcgaattgtgtttacatgagatgtcc
tcagatgcttcacttccaggggatccagaggcctatcctgctgctgtgtcaagcggtgga
gccattcatctgcagacaggagtggaaacagaagagatgagatcagcaattgctcctgat
cccattcctctgacacgggagtccacagctgatactagggctttgaatagatgtaaagcg
atgagtggatcatttcagcggggtcggttccaggtgattacaattcctcagcagcagtca
gcaaaaatgacatcttttggaatagaacacatatcagtgttcagtgagacaaaccattct
agtgaagaagcctttattgaaacagcaaagtctcagttggtagaaatagaacctgccaca
caaaatccaaaaacttcgttttcttctgagaagttacaagctcttcaggaaacctgtaaa
gaaaataaaggagttcccaaacaaggtgacaacttcttatctttcagcgcagcttgtgag
actgatgtatcttcagtgaccccagaaaaggaatttgaagaaacttcagccacaggaagt
agcatgcagtctggatctgaactgttgcttaaagagagagagatattgactgctgggaaa
cagcctagctctgatagtgaattttcagccagtcttgctggcagtggaaagtcagtggca
aagactggtccagagagtaatcagtgcttaccacaccacgaagaacaagcttatgctcaa
acacagagttcactcttctattcgccatcttccccaatgagcagtgatgatgaatcagaa
atagaggatgaggacttgaaggtggagcttcaaagattacgagaaaaacacattcaggag
gtggtaaatcttcaaacccagcagaataaggagctgcaggagctctatgaacgccttcgg
tcaattaaagatagcaaaacccaatctactgagattcctttgccacctgcatcaccacgt
cgaccaagatctttcaaaagcaaacttcgaagccgcccccagtccttgacacatgtggac
aatggcatagttgctacagatccactgtgtgtggagagtaatgcagcatcatgccaacag
tctccagccagtaaaaaagggatgttcacagatgacttacacaagctggtggatgactgg
acaaaggaagcagtaggaaattctcttattaagccaagtttaaaccaacttaaacaaagt
caacacaaactagagacagaaaactggaataaagtatctgaaaatactccgtctactatg
ggctacacatcaacatggatttcttctctgtcccaaatccgtggagctgtcccaacttcc
ttgccacaaggactctcactcccttcatttcctgggccattatcatcatatggaatgcct
cacgtttgtcagtataatgctgtggcgggggcggggtatccagtacagtgggtaggaatt
tcaggaacaacacaacaatctgtagtaattcccgcccaatctgggggaccattccagcca
gggatgaatatgcaggcatttccaagttcatcagtgcagaatcctgccacaatccctcct
ggtcctaaatga

DBGET integrated database retrieval system