KEGG   Pan paniscus (bonobo): 100978930
Entry
100978930         CDS       T02283                                 

Gene name
RUNX1T1
Definition
(RefSeq) RUNX1 translocation partner 1
  KO
K10053  CBFA2/RNUX1 translocation partner 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pps00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100978930 (RUNX1T1)
   05202 Transcriptional misregulation in cancer
    100978930 (RUNX1T1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100978930 (RUNX1T1)
SSDB
Motif
Pfam: NHR2 TAFH zf-MYND Efg1 DUF3731 MAJIN
Other DBs
NCBI-GeneID: 100978930
NCBI-ProteinID: XP_003821173
UniProt: A0A2R9APW9
Position
8
AA seq 584 aa
MVGLSGPVQYRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGT
SHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDI
SPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCA
RLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHS
EHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSH
RDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRR
CQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGY
VPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAED
ALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQ
GDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggtgggactctccggccctgtgcagtatcgtactgagaagcactccacaatgccagac
tcacctgtggatgtgaagacgcaatctaggctgactcctccaacgatgccacctccccca
actactcaaggagctccaagaaccagttcatttacaccgacaacgttaactaatggcacg
agccattctcctacagccttgaatggcgccccctcaccacccaatggcttcagcaatggg
ccttcctcttcttcctcctcctctctggctaatcaacagctgcccccagcctgtggtgcc
aggcaactcagcaagctgaaaaggttccttactaccctgcagcagtttggcaatgacatt
tcacccgagataggagaaagagttcgcaccctcgttctgggactagtgaactccactttg
acaattgaagaatttcattccaaactgcaagaagctactaacttcccactgcgacctttt
gtcatcccatttttgaaggccaacttgcccctgctgcagcgtgagctcctccactgcgca
agactggccaaacagaaccctgcccagtacctcgcccagcatgaacagctgcttctggat
gccagcaccacctcacctgttgactcctcagagctgcttctcgatgtgaacgaaaacggg
aagaggcgaactccagacagaaccaaagaaaatggctttgacagagagcctttgcactca
gaacatccaagcaagcgaccatgcactattagcccaggccagcggtacagtccaaataac
ggcttatcctaccagcccaatggcctgcctcaccctaccccacctccacctcagcattac
cgtttggatgatatggccattgcccaccactacagggactcctatcgacaccccagccac
agggacctcagggacagaaacagacctatggggttgcatggcacacgtcaagaagaaatg
attgatcacagactaacagacagagaatgggcagaagagtggaaacatcttgaccatctg
ttaaactgcataatggacatggtagaaaaaacaaggcgatctctcaccgtactaaggcga
tgtcaagaagcagaccgggaagaattgaattactggatccgacggtacagtgacgccgag
gacttaaaaaaaggtggcggcagtagcagcagccactctaggcagcagagtcccgtcaac
ccagacccagttgcactagacgcgcatcgggaattccttcacaggcctgcgtctggatat
gtgccagaggagatctggaagaaagctgaggaggccgtcaatgaggtgaagcgccaggcg
atgacggagctgcagaaggccgtgtctgaggcggagcggaaagcccacgacatgatcaca
acagagagggccaagatggagcgcacggtcgccgaggccaaacggcaggcggcggaggac
gcgctggcagttatcaatcagcaggaggattcaagcgagagttgctggaattgtggccgt
aaagcgagtgaaacctgcagtggctgtaacacagcccgatactgtggctcattttgccag
cacaaagactgggagaagcaccatcacatctgtggacagaccctgcaggcccagcagcag
ggagacacacctgcagtcagctcctctgtcacgcctaacagcggggctgggagcccgatg
gacacaccaccagcagccactccgaggtcaaccaccccgggaaccccttccaccatagag
acaacccctcgctag

DBGET integrated database retrieval system