KEGG   Pan paniscus (bonobo): 100979073
Entry
100979073         CDS       T02283                                 

Gene name
CCL17
Definition
(RefSeq) C-C motif chemokine ligand 17
  KO
K21083  C-C motif chemokine 17
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04062  Chemokine signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100979073 (CCL17)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100979073 (CCL17)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100979073 (CCL17)
   04657 IL-17 signaling pathway
    100979073 (CCL17)
   04062 Chemokine signaling pathway
    100979073 (CCL17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100979073 (CCL17)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Chemokines
   100979073 (CCL17)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100979073
NCBI-ProteinID: XP_003823792
Position
16
AA seq 122 aa
MGELNSKPGCLPEQRDLHTETPSWAPGTMAPLKMLALVTLLLGASLQHIHAARGTNVGRE
CCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLE
RS
NT seq 369 nt   +upstreamnt  +downstreamnt
atgggagagctgaattcaaaaccagggtgtctccctgagcagagagacctgcacacagag
actccctcctgggctcctggcaccatggccccactgaagatgctggccctggtcaccctc
ctcctgggggcttctctgcagcacatccacgcagctcgagggaccaatgtgggccgggag
tgctgcctggagtacttcaagggagccattccccttagaaagctgaagacgtggtaccag
acatctgaggactgctccagggatgccatcgtttttgtaactgtgcagggcagggccatc
tgttcggaccccaacaacaagagagtgaagaatgcagttaaatacctgcaaagccttgag
aggtcttga

DBGET integrated database retrieval system