KEGG   Pan paniscus (bonobo): 100979090
Entry
100979090         CDS       T02283                                 

Gene name
TYK2
Definition
(RefSeq) tyrosine kinase 2
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04217  Necroptosis
pps04380  Osteoclast differentiation
pps04621  NOD-like receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps05145  Toxoplasmosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100979090 (TYK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100979090 (TYK2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100979090 (TYK2)
   04658 Th1 and Th2 cell differentiation
    100979090 (TYK2)
   04659 Th17 cell differentiation
    100979090 (TYK2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100979090 (TYK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100979090 (TYK2)
   05160 Hepatitis C
    100979090 (TYK2)
   05171 Coronavirus disease - COVID-19
    100979090 (TYK2)
   05164 Influenza A
    100979090 (TYK2)
   05162 Measles
    100979090 (TYK2)
   05168 Herpes simplex virus 1 infection
    100979090 (TYK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100979090 (TYK2)
   05169 Epstein-Barr virus infection
    100979090 (TYK2)
   05165 Human papillomavirus infection
    100979090 (TYK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100979090 (TYK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100979090 (TYK2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100979090 (TYK2)
Protein kinases [BR:pps01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100979090 (TYK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kinase-like Kdo APH ABC1
Other DBs
NCBI-GeneID: 100979090
NCBI-ProteinID: XP_008960099
UniProt: A0A2R9C1D6
Position
19
AA seq 1190 aa
MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHI
AHKVGITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREP
AVYRCGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSSEEEIHHFK
NESLGMAFLHLCHLALRHGIPLQEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRR
FLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGVAP
TDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHK
AVGQLADRPREPLWAYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHP
YRLILTVAQRSQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRA
GDDCFSLRRCCLPQPGETSNLIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTR
TNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALAFYETAS
LMSQVSHMHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLRRERGHVPMAWKMVVAQQLAS
ALSYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWLA
PECLPVGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPE
LATLTSQCLTYEPTQRPSFRTILRDLTRLQPHTLPDLADVLTVNPDSPASDPTVFHKRYL
KKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHE
HIIKYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGMAYLHAQ
HYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYK
FYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRP
DKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC
NT seq 3573 nt   +upstreamnt  +downstreamnt
atgcctctgcgccactgggggatggccaggggcagtaagcccgttggggatggagcccag
cccatggctgccatgggaggcctgaaggtgcttctgcactgggctggtccaggcggcggg
gagccctgggtcactttcagtgagtcatcgctgacagctgaggaagtctgcatccacatt
gcacataaagttggtatcactcctccttgcttcaatctctttgccctcttcgatgctcag
gcccaagtctggttgcccccaaaccacatcctagagatccccagagacgcaagcctgatg
ctatatttccgcataaggttttatttccggaactggcatggcatgaatcctcgggaaccg
gctgtgtaccgttgtgggcccccaggaaccgaggcatcctcagatcagacagcacagggg
atgcaactcctggacccagcctcatttgagtacctctttgagcagggcaagcatgagttt
gtgaatgacgtggcatcactgtgggagctgtcgagcgaggaggagatccaccactttaag
aatgagagcctgggcatggcctttctgcacctctgtcacctcgctctccgccatggcatc
cccctgcaggaggtggccaagaagaccagcttcaaggactgcatcccgcgctccttccgt
cggcatatccggcagcacagcgccctgacccggctgcgccttcggaacgtcttccgcagg
ttcctgcgggacttccagccgggccgactctcccagcagatggtcatggtcaaataccta
gccacactcgagcggctggcaccccgcttcggcacagagcgtgtgcccgtgtgccacctg
aggctgctggcccaggccgagggggagccctgctacatccgggacagtggggtggcccct
acagaccctggccctgagtctgctgctgggcccccaacccacgaggtgctggtgacaggc
actggtggcatccagtggtggccagtagaggaggaggtgaacaaggaggagggttctagt
ggcagcagtggcaggaacccccaagccagcctgtttgggaagaaggccaaggctcacaag
gcagtcggccagctggcagacaggccgcgggagccactgtgggcctacttctgcgacttc
cgggacatcacccacgtggtgctgaaagagcactgtgtcagcatccaccggcaggacaac
aagtgcctggagctgagcttgccttcccgggctgcggcgctgtccttcgtgtcgctggtg
gacggctatttccgcctgacggccgactccagccactacctgtgccacgaggtggctccc
ccacggctggtgatgagcatccgggatgggatccacggacccctgctggagccatttgtg
caggccaagctgcggcccgaggacggcctgtacctcattcactggagcaccagccacccc
taccgcctgatcctcacagtggcccagcgtagccaggcaccagacggcatgcagagcttg
cggctccgaaagttccccattgagcagcaggacggggccttcgtgctggagggctggggc
cggtccttccccagcgttcgggaacttggggctgccttgcagggctgcttgctgagggcc
ggggatgactgcttctctctgcgtcgctgttgcctgccccaaccaggagaaacctccaat
ctcatcatcatgcggggggctcgggccagccccaggacactcaacctcagccagctcagc
ttccaccgggttgaccagaaggagatcacccagctgtcccacttgggccagggcacaagg
accaacgtgtatgagggccgcctgcgagtggagggcagcggggaccctgaggagggcaag
atggatgacgaggaccccctcgtgcctggcagggaccgtgggcaggagctacgagtggtg
ctcaaagtgctggaccctagtcaccatgacatcgccctggccttctacgagacagccagc
ctcatgagccaggtctcccacatgcacctggccttcgtgcatggcgtctgtgtgcgcggc
cctgaaaatatcatggtgacagagtacgtggagcacggacccctggatgtgtggctgcgg
agggagcggggccatgtgcccatggcttggaagatggtggtggcccagcagctggccagc
gccctcagctacctggagaacaagaacctggttcatggtaatgtgtgtggccggaacatc
ctgctggcccggctggggttggcagagggcaccagccccttcatcaagctgagtgatcct
ggcgtgggcctgggcgccctctccagggaggagcgggtggagaggatcccctggctggcc
cccgaatgcctaccagttggggccaacagcctaagcaccgccatggacaagtgggggttt
ggcgccaccctcctggagatctgctttgacggagaggcccctctgcagagccgcagtccc
tccgagaaggagcatttctaccagaggcagcaccggctgcccgagccctcctgcccagag
ctggccacactcaccagccagtgtctgacctatgagccaacccagaggccatcattccgc
accatcctgcgtgacctcacccggctgcagccccacactcttccagatcttgctgacgtc
ttgactgtgaacccggactcaccggcgtcggaccctacggttttccacaagcgctacttg
aaaaagatccgagatctgggcgagggtcacttcggcaaggtcagcttgtactgctacgat
ccgaccaacgacggcactggcgagatggtggcggtgaaagccctcaaggcagactgcggc
ccccagcaccgctcgggctggaagcaggagattgacattctgcgcacgctctaccacgag
cacatcatcaagtacaagggctgctgcgaggaccaaggcgagaagtcgctgcagctggtc
atggagtacgtgcccctgggcagcctccgagactacctgccccggcacagcgtcgggctg
gcccagctgctgctcttcgcccagcagatctgcgagggcatggcctatctgcacgcgcag
cactacatccaccgagacctagccgcgcgcaacgtgctgctggacaacgacaggctggtc
aagatcggggactttggcctagccaaggccgtgcccgaaggccacgagtactaccgcgtg
cgcgaggatggggacagccccgtgttctggtatgccccagagtgcctgaaggagtataag
ttctactatgcgtcagatgtctggtccttcggggtgaccctgtatgagctgctgacgcac
tgtgactccagccagagcccccccacgaaattccttgagctcataggcattgctcagggt
cagatgacagttctgagactcactgagttgctggaacgaggggagaggctgccacggccc
gacaaatgtccctgtgaggtctatcatctcatgaagaactgctgggagacagaggcgtcc
tttcgcccaaccttcgagaacctcatacccattctgaagacagtccatgagaagtaccaa
ggccaggccccttcagtgtttagcgtgtgctga

DBGET integrated database retrieval system