KEGG   Pan paniscus (bonobo): 100979219
Entry
100979219         CDS       T02283                                 

Gene name
RBM4B
Definition
(RefSeq) RNA-binding protein 4B
  KO
K13187  RNA-binding protein 4
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pps03041]
    100979219 (RBM4B)
Spliceosome [BR:pps03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    100979219 (RBM4B)
SSDB
Motif
Pfam: RRM_1 RRM_5 zf-CCHC RRM_occluded RRM_7 zf-CCHC_3 zf-CCHC_2 zf-CCHC_5
Other DBs
NCBI-GeneID: 100979219
NCBI-ProteinID: XP_003828747
UniProt: A0A2R8ZLH7
Position
11
AA seq 359 aa
MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKL
HGVNINVEASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMER
AEDAVEAIRGLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPVDRT
GRVADFTEQYNEQYGAVRTPYTMGYGESMYYNDAYGALDYYKRYRVRSYEAVAAAAAASA
YNYAEQTMSHLPQVQSTTVTSHLNSTSVDPYDRHLLPNSGAAATSAAMAAAAATTSSYYG
RDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSLYDMARYEREQYVDRARYSAF
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggtgaagctgttcatcggaaaccttccccgggaggccacagagcaggagattcgctct
cttttcgaacagtatgggaaggtgctggaatgtgacataattaagaattacggctttgtg
cacatagaagacaagacggcagctgaggatgccatacgcaacctgcaccattacaagctt
catggggtgaacatcaacgtggaagccagcaagaataagagcaaagcttcaaccaagtta
cacgtgggtaacatcagccccacttgtaccaaccaagagcttcgggccaagtttgaggag
tatggtccggtcatcgaatgtgacatcgtgaaagattatgccttcgtacacatggagcgg
gcagaggatgcagtggaggccatcaggggccttgacaacacagagtttcaaggcaaaaga
atgcatgtgcagttgtccacaagccggcttcggactgcccctggtatgggagaccagagt
ggctgctatcggtgtgggaaagaagggcactggtccaaagagtgcccagtagatcgtacg
ggtcgtgtggcagactttactgagcagtataatgaacaatatggagcagttcgaacacct
tacaccatgggctacggggaatccatgtattacaacgatgcatatggagcactcgattac
tataagcgataccgggtccgctcttatgaggcagtagcagcggcggcagcggcttctgca
tacaactacgcagagcagaccatgtcccatctgcctcaagtccaaagcacaactgtgacc
agccacctcaactctacttctgttgatccctatgacagacacctattgccaaactctggc
gctgctgccacttcagctgctatggctgctgctgcagccaccacttcctcctactatgga
agggacaggagcccactgcgtcgtgctgcagccatgctccccacagttggagagggctac
ggttatgggccagagagtgagttatctcaggcttccgccgctacacggaattctctgtat
gacatggcccggtatgaacgggagcagtatgtggaccgagcccggtactcagccttttaa

DBGET integrated database retrieval system