KEGG   Pan paniscus (bonobo): 100979244Help
Entry
100979244         CDS       T02283                                 

Gene name
PLEKHA3
Definition
(RefSeq) pleckstrin homology domain containing A3
  KO
K20313  pleckstrin homology domain-containing family A member 3
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100979244 (PLEKHA3)
Membrane trafficking [BR:pps04131]
 Endosome - Golgi transport
  Others
   Others
    100979244 (PLEKHA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH PH_11 PH_8 Muted PH_3 DUF5327
Motif
Other DBs
NCBI-GeneID: 100979244
NCBI-ProteinID: XP_003815558
UniProt: A0A2R9BBN7
Position
2B
AA seq 300 aa AA seqDB search
MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTR
MELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSEL
RLYCDLLMQQVHTIQEFVHHDENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAK
FKPEMFQLHHPDPLVSPVSPSPVQMMKRSVSHPGSCSSERSSHSIKEPVSTLHRLSQRRR
RTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggagggggtgttgtacaagtggaccaactatctcacaggctggcagcctcgttggttt
gttttagataatggaatcttatcctactatgattcacaagatgatgtttgcaaagggagc
aaaggaagcataaagatggcagtttgtgaaattaaagttcattcagcagacaacacaaga
atggaattaatcattcctggagagcagcatttctacatgaaggcagtgaatgcagctgaa
agacagaggtggctggtcgctctggggagctccaaagcatgtttgactgatacaaggact
aaaaaagaaaaagaaataagtgaaaccagtgaatcgctgaaaaccaaaatgtctgaactt
cgcctctactgtgacctcttaatgcagcaagttcatacgatacaggaatttgttcaccat
gatgagaatcattcatctcctagtgcagagaacatgaatgaagcctcttctctgcttagt
gccacgtgtaacacattcatcacaacgcttgaggaatgtgtgaagatagccaatgccaag
tttaaacctgagatgtttcaactgcaccatccggatcccttagtttctcctgtgtcacct
tctcctgttcaaatgatgaagcgttctgtcagccaccctggttcttgcagttcagagagg
agtagccactctataaaagaaccagtatctacacttcaccgactctcccagcgacgccga
agaacctactcagatacagattcttgtagtgatattcctcttgaagacccagatagacct
gttcactgttcaaaaaatacacttaatggagatttggcatcagcaaccattcctgaagaa
agcagacttatggccaaaaaacaatctgaatcagaagatactcttccatccttctcttcc
tga

DBGET integrated database retrieval system