KEGG   Pan paniscus (bonobo): 100979281Help
Entry
100979281         CDS       T02283                                 

Gene name
STKLD1
Definition
(RefSeq) serine/threonine kinase like domain containing 1
  KO
K17546  serine/threonine kinase-like domain-containing protein STKLD1
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100979281 (STKLD1)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: Other
  Other
   100979281 (STKLD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 100979281
NCBI-ProteinID: XP_003822470
UniProt: A0A2R9CD58
Position
9
AA seq 680 aa AA seqDB search
MLGPGSNRRRPTQGERGPGSPGEPMEKYQVLYQLNPGALGVNLVVEEMETKVKHVIKQVE
CMDDHYASQALEELMPLLKLRHAHISVYQELFITWNGEISSLYLCLVMEFNELSFQEVIE
DKRKAKKIIDSEWMQNVLGQVLDALEYLHHLDIIHRNLKPSNIILISSDHCKLQDLSSNV
LMTDKAKWNIRAEEDPFHKSWMAPEALNFSFSQKSDIWSLGCIILDMTSCSFMDGTEAMH
LRKSLRQSPGSLKAVLKTMEEKQIPDVETFGNLLPLMLQIDPSDRITIKDVVHITFVRGS
FKSSCVSLTLHRQMVPASITDMLLEGNVASILEVMQKFSGWPEVQLRAMKRLLKMPADQL
GLPWPPELVEVVVTTMQLHDRVLDVQLCACSLLLHLLGQALVHHPEAKTPCNQAITSTLL
SALQSHPEEEPLLVMVYSLLAITTTQESESLSDELQNAGLLEHILEHLNSSLESRDVCAS
GLGLLWALLLDGIIVNKAPLEKVPDLISQVLATYPADGEMAEASCGVFWLLSLLGCIKEQ
QFEQVVALLLQSIRLCQDRALLVNNAYRGLASLVKVSELAAFKVVVQEEGGSGLSLIKET
YQLHRDDPEVVENVGMLLVHLASYEEILPELVSSSMKALLQEIKERFTSSLVSDSSAFSK
PGLPPGGSPQLGCTTSGGLE
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgcttgggccagggtccaatcgcaggcgccccacgcagggggagcgaggcccagggtcc
cccggagagcccatggagaagtaccaggttttgtaccagctgaatcctggggccttgggg
gtgaacctggtggtggaggaaatggaaaccaaagtcaagcatgtgataaagcaggtggaa
tgcatggatgaccattacgccagtcaggccctggaggagctgatgccactgctgaagctg
cggcacgcccacatctctgtgtaccaggagctgttcatcacgtggaatggggagatctct
tctctgtacctctgcctggtgatggagttcaatgagctcagcttccaggaggtcattgag
gataagaggaaggcaaagaaaatcattgactctgagtggatgcagaatgtgctgggccag
gtgctggacgcgctggaatacctgcaccatttggacatcatccacaggaatctcaaaccc
tccaacatcatcctcatcagcagtgaccactgcaaactgcaggacctgagctccaacgtg
ctaatgacagacaaagccaaatggaatattcgtgcggaggaagacccctttcataagtcc
tggatggcccctgaagccctcaacttctccttcagccagaaatcagacatctggtccctg
ggctgcatcattctggacatgaccagctgctccttcatggatggcacagaagccatgcat
ctgcggaagtccctccgccagagcccaggcagcctgaaggccgtcctgaagacaatggag
gagaagcagatcccggatgtggaaaccttcgggaatcttctgcccttgatgctccagatc
gacccctcggatcgaataacgataaaggacgtggtgcacatcaccttcgtgagaggctcc
ttcaagtcctcgtgcgtctctctgaccctgcaccggcagatggtgcctgcgtccatcacc
gacatgctgttagaaggcaacgtggccagcattttagaggtcatgcagaaattctctggc
tggcccgaagtccagctcagggccatgaagaggcttctgaaaatgcctgcagatcagcta
ggtctgccgtggcccccggagctggtggaggtggtggtcacgaccatgcagctacatgac
agggtcctcgatgtccagctgtgtgcctgctccctgctgctgcacctcctgggccaagca
ctggtgcaccacccagaagccaagactccctgcaaccaagccatcacctccaccctgctg
agtgctcttcagagccaccccgaggaggagccacttcttgtcatggtctacagcctgcta
gccatcaccacaacccaggagtcagagtcactgtcagacgagctgcagaacgccgggctg
ctggagcacatcctggagcacctcaacagctccctcgaaagcagggacgtctgcgccagc
ggcctgggcctgctctgggccctcctgctggacggtatcattgtgaacaaggcccccttg
gagaaggtcccggacctcatcagccaggtgttggccacctaccctgcggatggggaaatg
gcggaagccagctgtggagtcttctggctgctgtccctgctgggctgcatcaaggagcag
cagtttgaacaagtggtggcgctgctcctgcaaagcatccggctgtgccaggacagagcc
ctgctggtgaacaatgcctaccggggactggccagcctggtgaaggtgtcagaactggcg
gccttcaaggtggtggtgcaggaggagggcggcagtggcctcagcctcatcaaggagacc
taccagctccacagggacgacccggaggtggtggagaacgtgggcatgctgctggtccac
ctggcttcctatgaggagatcctgccggagctagtgtccagtagtatgaaggccctgctc
caggagatcaaggagcgcttcacctccagcctggtgagtgacagcagcgccttcagcaaa
ccaggcctccctccaggtggaagcccccagctggggtgcaccacgtctgggggactggaa
tag

DBGET integrated database retrieval system