KEGG   Pan paniscus (bonobo): 100979313Help
Entry
100979313         CDS       T02283                                 

Gene name
QDPR
Definition
(RefSeq) quinoid dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00790  Folate biosynthesis
pps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100979313 (QDPR)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     100979313 (QDPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase PRMT5
Motif
Other DBs
NCBI-GeneID: 100979313
NCBI-ProteinID: XP_003826858
UniProt: A0A2R9BDT1
Position
4
AA seq 244 aa AA seqDB search
MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASIDVVENEEASASVVVKMTDSF
TEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSH
LATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKAAVHQLCQSLAGKNSGMPPGAAAIAV
LPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLMQVVTTEGRTELT
PAYF
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggctgcaggcgaagcgcgccgggtgctggtgtacggcggcaggggc
gctctgggttctcgatgcgtgcaggcttttcgggcccgcaactggtgggttgccagcatt
gatgtggtggagaatgaagaggccagcgctagcgtcgttgttaaaatgacagactcgttc
actgagcaggctgaccaggtgactgctgaggttggaaagctcttgggtgaagagaaggtg
gatgcaattctttgcgttgctggaggatgggccgggggcaatgccaaatccaagtctctc
tttaagaactgtgacctgatgtggaagcagagcatatggacatcgaccatctccagccat
ctggctaccaagcatctcaaggaaggaggcctcctgaccttggctggcgcaaaggctgcc
ctggatgggactcctggtatgatcgggtacggcatggccaaggctgctgttcaccagctc
tgccagagcctggctgggaagaacagcggcatgccgcccggggcagccgccatcgctgtg
ctcccggttaccctggataccccgatgaacaggaaatcaatgcctgaggctgacttcagc
tcctggacacccttagaattcctagttgaaactttccatgactggatcacagggaaaaac
cgaccgagctcaggaagcctaatgcaggtggtaaccacagaaggaaggacggaactcacc
ccagcatatttttag

DBGET integrated database retrieval system