KEGG   Pan paniscus (bonobo): 100979542
Entry
100979542         CDS       T02283                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps01524  Platinum drug resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04066  HIF-1 signaling pathway
pps04068  FoxO signaling pathway
pps04071  Sphingolipid signaling pathway
pps04072  Phospholipase D signaling pathway
pps04114  Oocyte meiosis
pps04140  Autophagy - animal
pps04148  Efferocytosis
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04210  Apoptosis
pps04218  Cellular senescence
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04350  TGF-beta signaling pathway
pps04360  Axon guidance
pps04370  VEGF signaling pathway
pps04371  Apelin signaling pathway
pps04380  Osteoclast differentiation
pps04510  Focal adhesion
pps04520  Adherens junction
pps04540  Gap junction
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04611  Platelet activation
pps04613  Neutrophil extracellular trap formation
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04668  TNF signaling pathway
pps04713  Circadian entrainment
pps04720  Long-term potentiation
pps04722  Neurotrophin signaling pathway
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04730  Long-term depression
pps04810  Regulation of actin cytoskeleton
pps04910  Insulin signaling pathway
pps04912  GnRH signaling pathway
pps04914  Progesterone-mediated oocyte maturation
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04917  Prolactin signaling pathway
pps04919  Thyroid hormone signaling pathway
pps04921  Oxytocin signaling pathway
pps04926  Relaxin signaling pathway
pps04928  Parathyroid hormone synthesis, secretion and action
pps04929  GnRH secretion
pps04930  Type II diabetes mellitus
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04960  Aldosterone-regulated sodium reabsorption
pps05010  Alzheimer disease
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05034  Alcoholism
pps05132  Salmonella infection
pps05133  Pertussis
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05203  Viral carcinogenesis
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05207  Chemical carcinogenesis - receptor activation
pps05208  Chemical carcinogenesis - reactive oxygen species
pps05210  Colorectal cancer
pps05211  Renal cell carcinoma
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05216  Thyroid cancer
pps05218  Melanoma
pps05219  Bladder cancer
pps05220  Chronic myeloid leukemia
pps05221  Acute myeloid leukemia
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05230  Central carbon metabolism in cancer
pps05231  Choline metabolism in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100979542 (MAPK3)
   04012 ErbB signaling pathway
    100979542 (MAPK3)
   04014 Ras signaling pathway
    100979542 (MAPK3)
   04015 Rap1 signaling pathway
    100979542 (MAPK3)
   04350 TGF-beta signaling pathway
    100979542 (MAPK3)
   04370 VEGF signaling pathway
    100979542 (MAPK3)
   04371 Apelin signaling pathway
    100979542 (MAPK3)
   04668 TNF signaling pathway
    100979542 (MAPK3)
   04066 HIF-1 signaling pathway
    100979542 (MAPK3)
   04068 FoxO signaling pathway
    100979542 (MAPK3)
   04072 Phospholipase D signaling pathway
    100979542 (MAPK3)
   04071 Sphingolipid signaling pathway
    100979542 (MAPK3)
   04024 cAMP signaling pathway
    100979542 (MAPK3)
   04022 cGMP-PKG signaling pathway
    100979542 (MAPK3)
   04151 PI3K-Akt signaling pathway
    100979542 (MAPK3)
   04150 mTOR signaling pathway
    100979542 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100979542 (MAPK3)
   04148 Efferocytosis
    100979542 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100979542 (MAPK3)
   04210 Apoptosis
    100979542 (MAPK3)
   04218 Cellular senescence
    100979542 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100979542 (MAPK3)
   04520 Adherens junction
    100979542 (MAPK3)
   04540 Gap junction
    100979542 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100979542 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100979542 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100979542 (MAPK3)
   04613 Neutrophil extracellular trap formation
    100979542 (MAPK3)
   04620 Toll-like receptor signaling pathway
    100979542 (MAPK3)
   04621 NOD-like receptor signaling pathway
    100979542 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    100979542 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    100979542 (MAPK3)
   04660 T cell receptor signaling pathway
    100979542 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    100979542 (MAPK3)
   04659 Th17 cell differentiation
    100979542 (MAPK3)
   04657 IL-17 signaling pathway
    100979542 (MAPK3)
   04662 B cell receptor signaling pathway
    100979542 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    100979542 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    100979542 (MAPK3)
   04062 Chemokine signaling pathway
    100979542 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100979542 (MAPK3)
   04929 GnRH secretion
    100979542 (MAPK3)
   04912 GnRH signaling pathway
    100979542 (MAPK3)
   04915 Estrogen signaling pathway
    100979542 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    100979542 (MAPK3)
   04917 Prolactin signaling pathway
    100979542 (MAPK3)
   04921 Oxytocin signaling pathway
    100979542 (MAPK3)
   04926 Relaxin signaling pathway
    100979542 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    100979542 (MAPK3)
   04919 Thyroid hormone signaling pathway
    100979542 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    100979542 (MAPK3)
   04916 Melanogenesis
    100979542 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100979542 (MAPK3)
   04270 Vascular smooth muscle contraction
    100979542 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100979542 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100979542 (MAPK3)
   04725 Cholinergic synapse
    100979542 (MAPK3)
   04726 Serotonergic synapse
    100979542 (MAPK3)
   04720 Long-term potentiation
    100979542 (MAPK3)
   04730 Long-term depression
    100979542 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    100979542 (MAPK3)
   04722 Neurotrophin signaling pathway
    100979542 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    100979542 (MAPK3)
   04380 Osteoclast differentiation
    100979542 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100979542 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100979542 (MAPK3)
   05206 MicroRNAs in cancer
    100979542 (MAPK3)
   05205 Proteoglycans in cancer
    100979542 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    100979542 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    100979542 (MAPK3)
   05203 Viral carcinogenesis
    100979542 (MAPK3)
   05230 Central carbon metabolism in cancer
    100979542 (MAPK3)
   05231 Choline metabolism in cancer
    100979542 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100979542 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100979542 (MAPK3)
   05212 Pancreatic cancer
    100979542 (MAPK3)
   05225 Hepatocellular carcinoma
    100979542 (MAPK3)
   05226 Gastric cancer
    100979542 (MAPK3)
   05214 Glioma
    100979542 (MAPK3)
   05216 Thyroid cancer
    100979542 (MAPK3)
   05221 Acute myeloid leukemia
    100979542 (MAPK3)
   05220 Chronic myeloid leukemia
    100979542 (MAPK3)
   05218 Melanoma
    100979542 (MAPK3)
   05211 Renal cell carcinoma
    100979542 (MAPK3)
   05219 Bladder cancer
    100979542 (MAPK3)
   05215 Prostate cancer
    100979542 (MAPK3)
   05213 Endometrial cancer
    100979542 (MAPK3)
   05224 Breast cancer
    100979542 (MAPK3)
   05223 Non-small cell lung cancer
    100979542 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100979542 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    100979542 (MAPK3)
   05161 Hepatitis B
    100979542 (MAPK3)
   05160 Hepatitis C
    100979542 (MAPK3)
   05171 Coronavirus disease - COVID-19
    100979542 (MAPK3)
   05164 Influenza A
    100979542 (MAPK3)
   05163 Human cytomegalovirus infection
    100979542 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100979542 (MAPK3)
   05165 Human papillomavirus infection
    100979542 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100979542 (MAPK3)
   05135 Yersinia infection
    100979542 (MAPK3)
   05133 Pertussis
    100979542 (MAPK3)
   05152 Tuberculosis
    100979542 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100979542 (MAPK3)
   05140 Leishmaniasis
    100979542 (MAPK3)
   05142 Chagas disease
    100979542 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100979542 (MAPK3)
   05020 Prion disease
    100979542 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    100979542 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    100979542 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100979542 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100979542 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100979542 (MAPK3)
   04934 Cushing syndrome
    100979542 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100979542 (MAPK3)
   01524 Platinum drug resistance
    100979542 (MAPK3)
   01522 Endocrine resistance
    100979542 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100979542 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100979542 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100979542 (MAPK3)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100979542 (MAPK3)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100979542 (MAPK3)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100979542 (MAPK3)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100979542 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 100979542
NCBI-ProteinID: XP_008959823
Ensembl: ENSPPAG00000038057
Position
18:complement(30864038..30873180)
AA seq 381 aa
MAAAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSS
AYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDV
YIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTC
DLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEM
LSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPK
SDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKE
RLKELIFQETARFQPGVLEAP
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggctcaggggggcgggggcggggagccccgtagaaccgag
ggggtcggcccgggggtcccgggggaggtggagatggtgaaggggcagccgttcgacgtg
ggcccgcgctacacgcagttgcagtacatcggcgagggcgcgtacggcatggtcagctcg
gcctatgaccacgtgcgcaagactcgcgtggccatcaagaagatcagccccttcgaacat
cagacctactgccagcgcacgctccgggagatccagatcctgctgcgcttccgccatgag
aatgtcatcggcatccgagacattctgcgggcgtccaccctggaagccatgagggatgtc
tacattgtgcaggacctgatggagactgacctgtacaagttgctgaaaagccagcagctg
agcaatgaccatatctgctatttcctctaccagatcctgcggggcctcaagtacatccac
tccgccaacgtgctccaccgagatctaaagccctccaacctgctcatcaacaccacctgc
gaccttaagatttgtgatttcggcctggcccggattgccgatcctgagcatgaccacacc
ggcttcctgacggagtatgtggctacgcgctggtaccgggccccagagatcatgctgaac
tccaagggctataccaagtccatcgacatctggtctgtgggctgcattctggctgagatg
ctctctaaccggcccatcttccctggcaagcactacctggatcagctcaaccacattctg
ggcatcctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccga
aactacctacagtctctgccctccaagaccaaggtggcttgggccaagcttttccccaag
tcagactccaaagcccttgacctgctggaccggatgttaacctttaaccccaataaacgg
atcacagtggaggaagcgctggctcacccctacctggagcagtactatgacccgacggat
gagccagtggccgaggagcccttcaccttcgccatggagctggatgacctacctaaggag
cggctgaaggagctcatcttccaggagacagcacgcttccagcccggagtgctggaggcc
ccctag

KEGG   Pan paniscus (bonobo): 100995567
Entry
100995567         CDS       T02283                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps01524  Platinum drug resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04066  HIF-1 signaling pathway
pps04068  FoxO signaling pathway
pps04071  Sphingolipid signaling pathway
pps04072  Phospholipase D signaling pathway
pps04114  Oocyte meiosis
pps04140  Autophagy - animal
pps04148  Efferocytosis
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04210  Apoptosis
pps04218  Cellular senescence
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04350  TGF-beta signaling pathway
pps04360  Axon guidance
pps04370  VEGF signaling pathway
pps04371  Apelin signaling pathway
pps04380  Osteoclast differentiation
pps04510  Focal adhesion
pps04520  Adherens junction
pps04540  Gap junction
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04611  Platelet activation
pps04613  Neutrophil extracellular trap formation
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04668  TNF signaling pathway
pps04713  Circadian entrainment
pps04720  Long-term potentiation
pps04722  Neurotrophin signaling pathway
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04730  Long-term depression
pps04810  Regulation of actin cytoskeleton
pps04910  Insulin signaling pathway
pps04912  GnRH signaling pathway
pps04914  Progesterone-mediated oocyte maturation
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04917  Prolactin signaling pathway
pps04919  Thyroid hormone signaling pathway
pps04921  Oxytocin signaling pathway
pps04926  Relaxin signaling pathway
pps04928  Parathyroid hormone synthesis, secretion and action
pps04929  GnRH secretion
pps04930  Type II diabetes mellitus
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps04960  Aldosterone-regulated sodium reabsorption
pps05010  Alzheimer disease
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05034  Alcoholism
pps05132  Salmonella infection
pps05133  Pertussis
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05203  Viral carcinogenesis
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05207  Chemical carcinogenesis - receptor activation
pps05208  Chemical carcinogenesis - reactive oxygen species
pps05210  Colorectal cancer
pps05211  Renal cell carcinoma
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05216  Thyroid cancer
pps05218  Melanoma
pps05219  Bladder cancer
pps05220  Chronic myeloid leukemia
pps05221  Acute myeloid leukemia
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05230  Central carbon metabolism in cancer
pps05231  Choline metabolism in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100995567 (MAPK1)
   04012 ErbB signaling pathway
    100995567 (MAPK1)
   04014 Ras signaling pathway
    100995567 (MAPK1)
   04015 Rap1 signaling pathway
    100995567 (MAPK1)
   04350 TGF-beta signaling pathway
    100995567 (MAPK1)
   04370 VEGF signaling pathway
    100995567 (MAPK1)
   04371 Apelin signaling pathway
    100995567 (MAPK1)
   04668 TNF signaling pathway
    100995567 (MAPK1)
   04066 HIF-1 signaling pathway
    100995567 (MAPK1)
   04068 FoxO signaling pathway
    100995567 (MAPK1)
   04072 Phospholipase D signaling pathway
    100995567 (MAPK1)
   04071 Sphingolipid signaling pathway
    100995567 (MAPK1)
   04024 cAMP signaling pathway
    100995567 (MAPK1)
   04022 cGMP-PKG signaling pathway
    100995567 (MAPK1)
   04151 PI3K-Akt signaling pathway
    100995567 (MAPK1)
   04150 mTOR signaling pathway
    100995567 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100995567 (MAPK1)
   04148 Efferocytosis
    100995567 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100995567 (MAPK1)
   04210 Apoptosis
    100995567 (MAPK1)
   04218 Cellular senescence
    100995567 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100995567 (MAPK1)
   04520 Adherens junction
    100995567 (MAPK1)
   04540 Gap junction
    100995567 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100995567 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100995567 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100995567 (MAPK1)
   04613 Neutrophil extracellular trap formation
    100995567 (MAPK1)
   04620 Toll-like receptor signaling pathway
    100995567 (MAPK1)
   04621 NOD-like receptor signaling pathway
    100995567 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    100995567 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    100995567 (MAPK1)
   04660 T cell receptor signaling pathway
    100995567 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    100995567 (MAPK1)
   04659 Th17 cell differentiation
    100995567 (MAPK1)
   04657 IL-17 signaling pathway
    100995567 (MAPK1)
   04662 B cell receptor signaling pathway
    100995567 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    100995567 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    100995567 (MAPK1)
   04062 Chemokine signaling pathway
    100995567 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100995567 (MAPK1)
   04929 GnRH secretion
    100995567 (MAPK1)
   04912 GnRH signaling pathway
    100995567 (MAPK1)
   04915 Estrogen signaling pathway
    100995567 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    100995567 (MAPK1)
   04917 Prolactin signaling pathway
    100995567 (MAPK1)
   04921 Oxytocin signaling pathway
    100995567 (MAPK1)
   04926 Relaxin signaling pathway
    100995567 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    100995567 (MAPK1)
   04919 Thyroid hormone signaling pathway
    100995567 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    100995567 (MAPK1)
   04916 Melanogenesis
    100995567 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100995567 (MAPK1)
   04270 Vascular smooth muscle contraction
    100995567 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100995567 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100995567 (MAPK1)
   04725 Cholinergic synapse
    100995567 (MAPK1)
   04726 Serotonergic synapse
    100995567 (MAPK1)
   04720 Long-term potentiation
    100995567 (MAPK1)
   04730 Long-term depression
    100995567 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    100995567 (MAPK1)
   04722 Neurotrophin signaling pathway
    100995567 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    100995567 (MAPK1)
   04380 Osteoclast differentiation
    100995567 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100995567 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100995567 (MAPK1)
   05206 MicroRNAs in cancer
    100995567 (MAPK1)
   05205 Proteoglycans in cancer
    100995567 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    100995567 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    100995567 (MAPK1)
   05203 Viral carcinogenesis
    100995567 (MAPK1)
   05230 Central carbon metabolism in cancer
    100995567 (MAPK1)
   05231 Choline metabolism in cancer
    100995567 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100995567 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100995567 (MAPK1)
   05212 Pancreatic cancer
    100995567 (MAPK1)
   05225 Hepatocellular carcinoma
    100995567 (MAPK1)
   05226 Gastric cancer
    100995567 (MAPK1)
   05214 Glioma
    100995567 (MAPK1)
   05216 Thyroid cancer
    100995567 (MAPK1)
   05221 Acute myeloid leukemia
    100995567 (MAPK1)
   05220 Chronic myeloid leukemia
    100995567 (MAPK1)
   05218 Melanoma
    100995567 (MAPK1)
   05211 Renal cell carcinoma
    100995567 (MAPK1)
   05219 Bladder cancer
    100995567 (MAPK1)
   05215 Prostate cancer
    100995567 (MAPK1)
   05213 Endometrial cancer
    100995567 (MAPK1)
   05224 Breast cancer
    100995567 (MAPK1)
   05223 Non-small cell lung cancer
    100995567 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100995567 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    100995567 (MAPK1)
   05161 Hepatitis B
    100995567 (MAPK1)
   05160 Hepatitis C
    100995567 (MAPK1)
   05171 Coronavirus disease - COVID-19
    100995567 (MAPK1)
   05164 Influenza A
    100995567 (MAPK1)
   05163 Human cytomegalovirus infection
    100995567 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100995567 (MAPK1)
   05165 Human papillomavirus infection
    100995567 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100995567 (MAPK1)
   05135 Yersinia infection
    100995567 (MAPK1)
   05133 Pertussis
    100995567 (MAPK1)
   05152 Tuberculosis
    100995567 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100995567 (MAPK1)
   05140 Leishmaniasis
    100995567 (MAPK1)
   05142 Chagas disease
    100995567 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100995567 (MAPK1)
   05020 Prion disease
    100995567 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    100995567 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    100995567 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100995567 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100995567 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100995567 (MAPK1)
   04934 Cushing syndrome
    100995567 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100995567 (MAPK1)
   01524 Platinum drug resistance
    100995567 (MAPK1)
   01522 Endocrine resistance
    100995567 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100995567 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100995567 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100995567 (MAPK1)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100995567 (MAPK1)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100995567 (MAPK1)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100995567 (MAPK1)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100995567 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 100995567
NCBI-ProteinID: XP_034804682
Ensembl: ENSPPAG00000024690
Position
23:complement(31305712..31412963)
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaacctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagcccctttgag
caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgacattattcgagcaccaaccatcgagcaaatgaaagat
gtatatatagtacaggacctcatggaaacagatctttacaagctcttgaagacacaacac
ctcagcaatgaccatatctgctattttctctaccagatcctcagagggttaaaatatatc
cattcagctaacgttctgcaccgtgacctcaagccttccaacctgctgctcaacaccacc
tgtgatctcaagatctgtgactttggcctggcccgtgttgcagatccagaccatgatcac
acagggttcctgacagaatatgtggccacacgttggtacagggctccagaaattatgttg
aattccaagggctacaccaagtccattgatatttggtctgtaggctgcattctggcagaa
atgctttctaacaggcccatctttccagggaagcattatcttgaccagctgaaccacatt
ttgggtattcttggatccccatcacaggaagacctgaattgtataataaatttaaaagct
aggaactatttgctttctcttccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgactccaaagctctggacttattggacaaaatgttgacattcaacccacacaag
aggattgaagtagaacaggctctggcccacccatatctggagcagtattacgacccgagt
gacgagcccatcgccgaagcaccattcaagttcgacatggaattggatgacttgcctaag
gaaaagctcaaagaactaatttttgaagagactgctagattccagccaggatacagatct
taa

DBGET integrated database retrieval system