KEGG   Pan paniscus (bonobo): 100979574
Entry
100979574         CDS       T02283                                 

Gene name
IL12A
Definition
(RefSeq) interleukin 12A
  KO
K05406  interleukin 12A
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04620  Toll-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04940  Type I diabetes mellitus
pps05133  Pertussis
pps05134  Legionellosis
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05143  African trypanosomiasis
pps05144  Malaria
pps05145  Toxoplasmosis
pps05146  Amoebiasis
pps05152  Tuberculosis
pps05162  Measles
pps05164  Influenza A
pps05168  Herpes simplex virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05321  Inflammatory bowel disease
pps05330  Allograft rejection
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100979574 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100979574 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100979574 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    100979574 (IL12A)
   04625 C-type lectin receptor signaling pathway
    100979574 (IL12A)
   04658 Th1 and Th2 cell differentiation
    100979574 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100979574 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100979574 (IL12A)
   05164 Influenza A
    100979574 (IL12A)
   05162 Measles
    100979574 (IL12A)
   05168 Herpes simplex virus 1 infection
    100979574 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100979574 (IL12A)
   05134 Legionellosis
    100979574 (IL12A)
   05152 Tuberculosis
    100979574 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100979574 (IL12A)
   05144 Malaria
    100979574 (IL12A)
   05145 Toxoplasmosis
    100979574 (IL12A)
   05140 Leishmaniasis
    100979574 (IL12A)
   05142 Chagas disease
    100979574 (IL12A)
   05143 African trypanosomiasis
    100979574 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100979574 (IL12A)
   05330 Allograft rejection
    100979574 (IL12A)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100979574 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100979574 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100979574 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100979574 (IL12A)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100979574 (IL12A)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Cytokines
   100979574 (IL12A)
SSDB
Motif
Pfam: IL12 Rh5
Other DBs
NCBI-GeneID: 100979574
NCBI-ProteinID: XP_003830676
UniProt: A0A2R9BQY2
Position
3
AA seq 253 aa
MWPPGSASQPPPSPAAATGLHPAARPVSLQCRLSMCPARSLLLVATLVLLDHLSLARNLP
VATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACL
PLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLL
MDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEELDFYKTKIKLCILLHAFRIRA
VTIDRVMSYLNAS
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtggccccctgggtcagcctcccagccaccgccctcacctgccgcggccacaggtctg
catccagcggctcgcccagtgtccctgcagtgccggctcagcatgtgtccagcgcgcagc
ctcctccttgtggctaccctggtcctcctggaccacctcagtttggccagaaacctcccc
gtggccaccccagacccaggaatgttcccatgccttcaccactcccaaaacctgctgagg
gccgtcagcaacatgctccagaaggccagacaaactctagaattttacccttgcacttct
gaagagattgatcatgaagatatcacaaaagataaaaccagcacagtggaggcctgttta
ccattggaattaaccaagaatgagagttgcctaaattccagagagacctctttcataact
aatgggagttgcctggcctccagaaagacctcttttatgatggccctgtgccttagtagt
atttatgaagacttgaagatgtaccaggtggagttcaagaccatgaatgcaaagcttctg
atggatcctaagaggcagatctttctagatcaaaacatgctggcagttattgacgagctg
atgcaggccctgaatttcaacagtgagactgtgccacaaaaatcctcccttgaagaactg
gatttttataaaactaaaatcaagctctgcatacttcttcatgctttcagaattcgggca
gtgactattgatagagtgatgagctatctgaatgcttcctaa

DBGET integrated database retrieval system